Ursus americanus (American black bear): 123777926 Help Entry 123777926         CDS       T07931                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism uar  Ursus americanus (American black bear) Pathway uar03082   ATP-dependent chromatin remodeling uar04015   Rap1 signaling pathway uar04145   Phagosome uar04210   Apoptosis uar04390   Hippo signaling pathway uar04510   Focal adhesion uar04520   Adherens junction uar04530   Tight junction uar04611   Platelet activation uar04613   Neutrophil extracellular trap formation uar04670   Leukocyte transendothelial migration uar04714   Thermogenesis uar04810   Regulation of actin cytoskeleton uar04814   Motor proteins uar04820   Cytoskeleton in muscle cells uar04919   Thyroid hormone signaling pathway uar04921   Oxytocin signaling pathway uar04971   Gastric acid secretion uar05014   Amyotrophic lateral sclerosis uar05100   Bacterial invasion of epithelial cells uar05132   Salmonella infection uar05135   Yersinia infection uar05164   Influenza A uar05205   Proteoglycans in cancer uar05225   Hepatocellular carcinoma uar05410   Hypertrophic cardiomyopathy uar05412   Arrhythmogenic right ventricular cardiomyopathy uar05414   Dilated cardiomyopathy uar05416   Viral myocarditis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     123777926 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     123777926 (ACTG1)    04390 Hippo signaling pathway     123777926 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123777926 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     123777926 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     123777926 (ACTG1)    04520 Adherens junction     123777926 (ACTG1)    04530 Tight junction     123777926 (ACTG1)   09142 Cell motility    04814 Motor proteins     123777926 (ACTG1)    04820 Cytoskeleton in muscle cells     123777926 (ACTG1)    04810 Regulation of actin cytoskeleton     123777926 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     123777926 (ACTG1)    04613 Neutrophil extracellular trap formation     123777926 (ACTG1)    04670 Leukocyte transendothelial migration     123777926 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     123777926 (ACTG1)    04919 Thyroid hormone signaling pathway     123777926 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     123777926 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     123777926 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     123777926 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     123777926 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     123777926 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     123777926 (ACTG1)    05135 Yersinia infection     123777926 (ACTG1)    05100 Bacterial invasion of epithelial cells     123777926 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     123777926 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     123777926 (ACTG1)    05410 Hypertrophic cardiomyopathy     123777926 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     123777926 (ACTG1)    05414 Dilated cardiomyopathy     123777926 (ACTG1)    05416 Viral myocarditis     123777926 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:uar03021]     123777926 (ACTG1)    03019 Messenger RNA biogenesis [BR:uar03019]     123777926 (ACTG1)    03036 Chromosome and associated proteins [BR:uar03036]     123777926 (ACTG1)    03029 Mitochondrial biogenesis [BR:uar03029]     123777926 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:uar04812]     123777926 (ACTG1)    04147 Exosome [BR:uar04147]     123777926 (ACTG1) Transcription machinery [BR:uar03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      123777926 (ACTG1) Messenger RNA biogenesis [BR:uar03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      123777926 (ACTG1) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      123777926 (ACTG1)     NuA4 complex      123777926 (ACTG1)   Chromatin remodeling factors    BAF complex     123777926 (ACTG1)    PBAF complex     123777926 (ACTG1)    GBAF(ncBAF) complex     123777926 (ACTG1)    SWR1 complex     123777926 (ACTG1) Mitochondrial biogenesis [BR:uar03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     123777926 (ACTG1) Cytoskeleton proteins [BR:uar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      123777926 (ACTG1) Exosome [BR:uar04147]  Exosomal proteins   Proteins found in most exosomes    123777926 (ACTG1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  123777926 NCBI-ProteinID:  XP_045630929 UniProt:  A0A452RQD5 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaggagatcgccgcgctcgttatcgacaatggctccggcatgtgcaaggcgggc tttgctggggatgacgccccccgagccgtgtttccgtccatcgtcgggcgaccccgacac cagggcgtgatggtgggtatgggccagaaggactcgtacgtgggcgacgaggcccagagc aagcgcggcatcctgaccctcaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccataccttctacaacgagctgcgcgtggcccccgaggag caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgact cagatcatgttcgagaccttcaacaccccagccatgtatgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccactggtattgtcatggactctggggacggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgtggctacagcttc accaccaccgccgagcgggaaatcgtgcgtgacatcaaagagaagctgtgctacgtcgcc ctggacttcgagcaggagatggccacggccgcatcgtcctcctccctggagaagagctat gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgcccagaggcg ctcttccagccctccttcttggggatggagtcctgtggtatccacgagaccactttcaac tccatcatgaagtgtgacgtcgacatccgcaaggacctctacgccaacacggtgctgtcc ggtgggaccaccatgtaccccggcatcgccgacaggatgcagaaggagatcacagccctg gcgcccagcacgatgaagatcaagatcatcgctcctcctgagcgcaagtactcggtgtgg atcgggggctccatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system