Ursus americanus (American black bear): 123779108 Help Entry 123779108         CDS       T07931                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism uar  Ursus americanus (American black bear) Pathway uar04022   cGMP-PKG signaling pathway uar04024   cAMP signaling pathway uar04066   HIF-1 signaling pathway uar04270   Vascular smooth muscle contraction uar04714   Thermogenesis uar04921   Oxytocin signaling pathway uar04923   Regulation of lipolysis in adipocytes uar04924   Renin secretion uar04925   Aldosterone synthesis and secretion uar05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     123779108 (NPPA)    04024 cAMP signaling pathway     123779108 (NPPA)    04022 cGMP-PKG signaling pathway     123779108 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     123779108 (NPPA)    04921 Oxytocin signaling pathway     123779108 (NPPA)    04924 Renin secretion     123779108 (NPPA)    04925 Aldosterone synthesis and secretion     123779108 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     123779108 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     123779108 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     123779108 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123779108 (NPPA) Cytokines and neuropeptides [BR:uar04052]  Neuropeptides   Neuropeptides (Unclassified)    123779108 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  123779108 NCBI-ProteinID:  XP_045632837 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MDSPTITASFLLFLAFQLLGQMGANPAYGSVSNADLMDFKNLLDHLEDKMPLEDEVVPPQ VLSEQNEEAGAALSPLPEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAA PRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggactcccccaccatcaccgcaagtttcctcctcttcctggcatttcaactcctgggg caaatgggagctaaccctgcgtatggctctgtgtccaacgcagacctgatggatttcaag aatttgctggaccacttggaggacaagatgcctttagaagatgaggtcgtgcctccacaa gtactaagtgagcagaatgaggaagctggggcggctctcagccccctccctgaggtgcct ccctggacgggggaggtcaacccagcccagagagatgggggtgcccttgggcggggcccc tgggatgcctccgatagatctgccctcctgaaaagcaagctgagggcactgcttgctgcc cctcggagcctgcggaggtccagctgcttcggaggcaggatggacaggattggagcccag agtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system