Ursus americanus (American black bear): 123781031 Help Entry 123781031         CDS       T07931                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04151   PI3K-Akt signaling pathway uar04217   Necroptosis uar04380   Osteoclast differentiation uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04622   RIG-I-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar04630   JAK-STAT signaling pathway uar04650   Natural killer cell mediated cytotoxicity uar04668   TNF signaling pathway uar04936   Alcoholic liver disease uar05135   Yersinia infection uar05142   Chagas disease uar05152   Tuberculosis uar05160   Hepatitis C uar05161   Hepatitis B uar05162   Measles uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05165   Human papillomavirus infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05168   Herpes simplex virus 1 infection uar05169   Epstein-Barr virus infection uar05170   Human immunodeficiency virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123781031 (IFNB1)    04668 TNF signaling pathway     123781031 (IFNB1)    04151 PI3K-Akt signaling pathway     123781031 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123781031 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123781031 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123781031 (IFNB1)    04621 NOD-like receptor signaling pathway     123781031 (IFNB1)    04622 RIG-I-like receptor signaling pathway     123781031 (IFNB1)    04623 Cytosolic DNA-sensing pathway     123781031 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     123781031 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     123781031 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123781031 (IFNB1)    05161 Hepatitis B     123781031 (IFNB1)    05160 Hepatitis C     123781031 (IFNB1)    05171 Coronavirus disease - COVID-19     123781031 (IFNB1)    05164 Influenza A     123781031 (IFNB1)    05162 Measles     123781031 (IFNB1)    05168 Herpes simplex virus 1 infection     123781031 (IFNB1)    05163 Human cytomegalovirus infection     123781031 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     123781031 (IFNB1)    05169 Epstein-Barr virus infection     123781031 (IFNB1)    05165 Human papillomavirus infection     123781031 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     123781031 (IFNB1)    05152 Tuberculosis     123781031 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     123781031 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123781031 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123781031 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123781031 (IFNB1) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interferons    123781031 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  123781031 NCBI-ProteinID:  XP_045636246 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAVNYNLLRFQLSSSSVECQELLLQLNGTTKDCLKDRMNFK FPEEIEKSQQFQKEDFILVTLEMFQKTSDIFRRNLSSTGWNEIIVKNLLETLHWQKEHLE EILEKIMEEENFTWDDRTLLHLKKYYLRIVRYLKAKEYSICAWTIVQAEMLRSFFFLDKL TDYLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgcatcctccaaaccgctctcctggtgtatttctccaccacggttctc gccgtgaactacaacttgcttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctgcagttgaatggaacgactaaagattgcctcaaggaccggatgaacttcaag ttccctgaggagatcgagaaatcccagcagttccagaaggaggacttcatattggtcacc cttgagatgttccagaagacctctgatattttcaggagaaatctctcgagcacagggtgg aatgagatcattgtcaagaacctccttgagacgctccattggcagaaggaacatctggag gaaatcctggagaaaatcatggaggaggaaaacttcacctgggacgacaggacccttctg cacctgaagaaatattatctaaggatcgtgcgatacctgaaggccaaggagtacagcatt tgtgcctggacaatagtgcaagcagagatgctcaggagctttttcttccttgataaactt acggattatctcccaaactga

DBGET integrated database retrieval system