Ursus americanus (American black bear): 123785123 Help Entry 123785123         CDS       T07931                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism uar  Ursus americanus (American black bear) Pathway uar00510   N-Glycan biosynthesis uar00513   Various types of N-glycan biosynthesis uar04141   Protein processing in endoplasmic reticulum Module uar_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:uar00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     123785123 (TMEM258)    00513 Various types of N-glycan biosynthesis     123785123 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123785123 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  123785123 NCBI-ProteinID:  XP_045642785 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaaccctgctgtcttcccccat ctgaccgtggtgctcttggcaattggcatgttctttactgcctggttcttcgtttatgag gttacctccaccaagtacactcgggatatctacaaagagctcctcatctccttggtggcc tcgctcttcatgggctttggagtcctcttcctcctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system