Ursus americanus (American black bear): 123787151 Help Entry 123787151         CDS       T07931                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism uar  Ursus americanus (American black bear) Pathway uar04010   MAPK signaling pathway uar04014   Ras signaling pathway uar04015   Rap1 signaling pathway uar04024   cAMP signaling pathway uar04062   Chemokine signaling pathway uar04510   Focal adhesion uar04517   IgSF CAM signaling uar04520   Adherens junction uar04611   Platelet activation uar04670   Leukocyte transendothelial migration uar04720   Long-term potentiation uar04722   Neurotrophin signaling pathway uar04934   Cushing syndrome uar04972   Pancreatic secretion uar05211   Renal cell carcinoma uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123787151 (RAP1B)    04014 Ras signaling pathway     123787151 (RAP1B)    04015 Rap1 signaling pathway     123787151 (RAP1B)    04024 cAMP signaling pathway     123787151 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123787151 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     123787151 (RAP1B)    04520 Adherens junction     123787151 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     123787151 (RAP1B)    04670 Leukocyte transendothelial migration     123787151 (RAP1B)    04062 Chemokine signaling pathway     123787151 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     123787151 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     123787151 (RAP1B)    04722 Neurotrophin signaling pathway     123787151 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     123787151 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123787151 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     123787151 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123787151 (RAP1B)    04031 GTP-binding proteins [BR:uar04031]     123787151 (RAP1B) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123787151 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    123787151 (RAP1B)   Exosomal proteins of colorectal cancer cells    123787151 (RAP1B) GTP-binding proteins [BR:uar04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     123787151 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 Motif Other DBs NCBI-GeneID:  123787151 NCBI-ProteinID:  XP_045645588 UniProt:  A0A452QXV9 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKIRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataaactagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttac agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagacttatacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagatccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system