Ursus americanus (American black bear): 123787294 Help Entry 123787294         CDS       T07931                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism uar  Ursus americanus (American black bear) Pathway uar03050   Proteasome uar04060   Cytokine-cytokine receptor interaction uar04066   HIF-1 signaling pathway uar04217   Necroptosis uar04350   TGF-beta signaling pathway uar04380   Osteoclast differentiation uar04612   Antigen processing and presentation uar04630   JAK-STAT signaling pathway uar04650   Natural killer cell mediated cytotoxicity uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04940   Type I diabetes mellitus uar05140   Leishmaniasis uar05142   Chagas disease uar05143   African trypanosomiasis uar05144   Malaria uar05145   Toxoplasmosis uar05146   Amoebiasis uar05152   Tuberculosis uar05160   Hepatitis C uar05164   Influenza A uar05168   Herpes simplex virus 1 infection uar05200   Pathways in cancer uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05321   Inflammatory bowel disease uar05322   Systemic lupus erythematosus uar05323   Rheumatoid arthritis uar05330   Allograft rejection uar05332   Graft-versus-host disease uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     123787294 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     123787294 (IFNG)    04630 JAK-STAT signaling pathway     123787294 (IFNG)    04066 HIF-1 signaling pathway     123787294 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123787294 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123787294 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     123787294 (IFNG)    04612 Antigen processing and presentation     123787294 (IFNG)    04660 T cell receptor signaling pathway     123787294 (IFNG)    04658 Th1 and Th2 cell differentiation     123787294 (IFNG)    04659 Th17 cell differentiation     123787294 (IFNG)    04657 IL-17 signaling pathway     123787294 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     123787294 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123787294 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123787294 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     123787294 (IFNG)    05164 Influenza A     123787294 (IFNG)    05168 Herpes simplex virus 1 infection     123787294 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     123787294 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     123787294 (IFNG)    05144 Malaria     123787294 (IFNG)    05145 Toxoplasmosis     123787294 (IFNG)    05140 Leishmaniasis     123787294 (IFNG)    05142 Chagas disease     123787294 (IFNG)    05143 African trypanosomiasis     123787294 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     123787294 (IFNG)    05323 Rheumatoid arthritis     123787294 (IFNG)    05321 Inflammatory bowel disease     123787294 (IFNG)    05330 Allograft rejection     123787294 (IFNG)    05332 Graft-versus-host disease     123787294 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     123787294 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     123787294 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:uar03051]     123787294 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123787294 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123787294 (IFNG) Proteasome [BR:uar03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     123787294 (IFNG) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interferons    123787294 (IFNG) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Cytokines    123787294 (IFNG) SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma MSC6_C DUF7774 TAD3_N Motif Other DBs NCBI-GeneID:  123787294 NCBI-ProteinID:  XP_045645905 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR EESDKTIIQSQIVSFYLKLFENFKDNQVIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQ IPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctatatcttagctttccagctttgcgtgattttgtgttcttctggc tattactgtcaggccatgttttttaaagaaatagaaaacctgaaggaatattttaatgca agtaatccagatgtagcagatggtggccctcttttcttagatattttgaagaactggaga gaggagagtgacaaaacgatcattcaaagccaaatcgtctccttctacttgaaactgttc gaaaactttaaagataaccaggtcattcaaaggagcatggacaccatcaaggaggacatg cttttcaagttcttcaacagcagtaccagtaagcggagtgacttccttaagctgattcaa attcccgtgaatgatatgcaggttcagcgcaaagcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgtttcga ggccgcagagcatcgaaataa

DBGET integrated database retrieval system