Ursus americanus (American black bear): 123788312 Help Entry 123788312         CDS       T07931                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism uar  Ursus americanus (American black bear) Pathway uar00564   Glycerophospholipid metabolism uar00565   Ether lipid metabolism uar00590   Arachidonic acid metabolism uar00591   Linoleic acid metabolism uar00592   alpha-Linolenic acid metabolism uar01100   Metabolic pathways uar04014   Ras signaling pathway uar04270   Vascular smooth muscle contraction uar04972   Pancreatic secretion uar04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:uar00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     123788312 (PLA2G1B)    00565 Ether lipid metabolism     123788312 (PLA2G1B)    00590 Arachidonic acid metabolism     123788312 (PLA2G1B)    00591 Linoleic acid metabolism     123788312 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     123788312 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123788312 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     123788312 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     123788312 (PLA2G1B)    04975 Fat digestion and absorption     123788312 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123788312 (PLA2G1B) Enzymes [BR:uar01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      123788312 (PLA2G1B) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     123788312 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Phospholip_A2_2 Motif Other DBs NCBI-GeneID:  123788312 NCBI-ProteinID:  XP_045647576 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MKFLVLAALLTVAAADGGISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGSGTPV DELDKCCQTHDNCYSEAKKLDSCKFLLDNPYTNTYSYSCSGSEITCSEKNKACEAFVCNC DRSAAICFSKAPYNKENKNLDTKKYCKD NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaaatttcttgtactggctgctctcctcacagtggccgctgccgatgggggcatcagc ccgcgggcagtgtggcagttccgcaacatgatcaagtgcactatccccgggagtgatccc ctgaaggactacaacaactacggctgctactgtggcctgggtggatccggcacccctgtg gatgaactggacaagtgttgccagacccacgacaactgctactcagaagccaagaaactg gacagctgtaaattcctcctggataacccctacaccaatacctactcatactcgtgctct ggctctgagatcacctgcagcgaaaaaaacaaagcctgtgaggctttcgtctgtaactgt gaccgcagtgctgccatctgcttttcaaaggccccatataacaaggagaacaagaatctt gacaccaagaagtactgtaaggattga

DBGET integrated database retrieval system