Ursus americanus (American black bear): 123788681 Help Entry 123788681         CDS       T07931                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism uar  Ursus americanus (American black bear) Pathway uar01521   EGFR tyrosine kinase inhibitor resistance uar01523   Antifolate resistance uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04066   HIF-1 signaling pathway uar04068   FoxO signaling pathway uar04151   PI3K-Akt signaling pathway uar04218   Cellular senescence uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar04625   C-type lectin receptor signaling pathway uar04630   JAK-STAT signaling pathway uar04640   Hematopoietic cell lineage uar04657   IL-17 signaling pathway uar04659   Th17 cell differentiation uar04668   TNF signaling pathway uar04672   Intestinal immune network for IgA production uar04931   Insulin resistance uar04932   Non-alcoholic fatty liver disease uar04933   AGE-RAGE signaling pathway in diabetic complications uar04936   Alcoholic liver disease uar05010   Alzheimer disease uar05020   Prion disease uar05022   Pathways of neurodegeneration - multiple diseases uar05132   Salmonella infection uar05133   Pertussis uar05134   Legionellosis uar05135   Yersinia infection uar05142   Chagas disease uar05143   African trypanosomiasis uar05144   Malaria uar05146   Amoebiasis uar05152   Tuberculosis uar05161   Hepatitis B uar05162   Measles uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05168   Herpes simplex virus 1 infection uar05169   Epstein-Barr virus infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05202   Transcriptional misregulation in cancer uar05321   Inflammatory bowel disease uar05323   Rheumatoid arthritis uar05332   Graft-versus-host disease uar05410   Hypertrophic cardiomyopathy uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123788681 (IL6)    04668 TNF signaling pathway     123788681 (IL6)    04066 HIF-1 signaling pathway     123788681 (IL6)    04068 FoxO signaling pathway     123788681 (IL6)    04151 PI3K-Akt signaling pathway     123788681 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123788681 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     123788681 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     123788681 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123788681 (IL6)    04620 Toll-like receptor signaling pathway     123788681 (IL6)    04621 NOD-like receptor signaling pathway     123788681 (IL6)    04623 Cytosolic DNA-sensing pathway     123788681 (IL6)    04625 C-type lectin receptor signaling pathway     123788681 (IL6)    04659 Th17 cell differentiation     123788681 (IL6)    04657 IL-17 signaling pathway     123788681 (IL6)    04672 Intestinal immune network for IgA production     123788681 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123788681 (IL6)    05202 Transcriptional misregulation in cancer     123788681 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123788681 (IL6)    05161 Hepatitis B     123788681 (IL6)    05171 Coronavirus disease - COVID-19     123788681 (IL6)    05164 Influenza A     123788681 (IL6)    05162 Measles     123788681 (IL6)    05168 Herpes simplex virus 1 infection     123788681 (IL6)    05163 Human cytomegalovirus infection     123788681 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     123788681 (IL6)    05169 Epstein-Barr virus infection     123788681 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     123788681 (IL6)    05135 Yersinia infection     123788681 (IL6)    05133 Pertussis     123788681 (IL6)    05134 Legionellosis     123788681 (IL6)    05152 Tuberculosis     123788681 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     123788681 (IL6)    05144 Malaria     123788681 (IL6)    05142 Chagas disease     123788681 (IL6)    05143 African trypanosomiasis     123788681 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     123788681 (IL6)    05321 Inflammatory bowel disease     123788681 (IL6)    05332 Graft-versus-host disease     123788681 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     123788681 (IL6)    05020 Prion disease     123788681 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     123788681 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123788681 (IL6)    05410 Hypertrophic cardiomyopathy     123788681 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123788681 (IL6)    04932 Non-alcoholic fatty liver disease     123788681 (IL6)    04931 Insulin resistance     123788681 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     123788681 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     123788681 (IL6)    01523 Antifolate resistance     123788681 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123788681 (IL6) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123788681 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL11 IL23 PRRSV_Env Motif Other DBs NCBI-GeneID:  123788681 NCBI-ProteinID:  XP_045648127 LinkDB All DBs Position Unknown AA seq 251 aa AA seqDB search MSEAHSALEPTRNERELHLPSRTPAMNSLSTTVQFAHWLLSLASGTGAFSPVAFSLGLLL VMATAFPTPGHLGRDPKDEATSNRPPLISADKMEIIKYILGRISALKKEMCDKYNKCEDS KEALAENNLHLPKLAEKDGCFQSGFNQDTCLTRIATGLLEFQVHLKYLQANYEGDKENAN SVYFSTKVLLQMLMEKVKNQDEVTTPDPTTDTGLQAILKSQDKWLKQTTIHLILRNLEDF LQFSLRAVRVM NT seq 756 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggctcattctgccctcgagcccaccaggaacgaaagagagctccatctgccc tccaggaccccagctatgaactccctctccacaactgtgcagtttgctcactggctgctc tccctcgcctccggcacaggcgccttcagtccagttgccttctccctggggctgctcctg gtgatggctactgctttccctaccccgggacacctgggaagagatcccaaagatgaggcc acctcaaatagaccaccactcatctctgcagacaaaatggaaatcattaaatacatcctc ggcagaatctctgcactgaaaaaggagatgtgtgacaagtataacaagtgtgaagacagc aaggaggcactggcagaaaacaacttacatcttccaaaactggcagaaaaggacggatgc ttccaatctgggttcaatcaggacacctgcctgacaagaatcgctaccggtcttctggag tttcaggtacacctgaaatacctccaggccaactatgaaggtgataaggaaaatgccaac tctgtgtacttcagtaccaaagtcctgctccagatgctgatggaaaaggtaaagaatcag gatgaagtgaccaccccagaccccaccacagacaccggcctgcaggctatcctgaagtcg caggacaagtggctgaagcaaacaacaattcacctcatcctgcggaaccttgaggatttc ctgcagttcagcctgcgggctgtgcgggtcatgtag

DBGET integrated database retrieval system