Ursus americanus (American black bear): 123790366 Help Entry 123790366         CDS       T07931                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04151   PI3K-Akt signaling pathway uar04630   JAK-STAT signaling pathway uar04640   Hematopoietic cell lineage uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04664   Fc epsilon RI signaling pathway uar04672   Intestinal immune network for IgA production uar05140   Leishmaniasis uar05200   Pathways in cancer uar05310   Asthma uar05320   Autoimmune thyroid disease uar05321   Inflammatory bowel disease uar05330   Allograft rejection Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123790366 (IL4)    04151 PI3K-Akt signaling pathway     123790366 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123790366 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123790366 (IL4)    04660 T cell receptor signaling pathway     123790366 (IL4)    04658 Th1 and Th2 cell differentiation     123790366 (IL4)    04659 Th17 cell differentiation     123790366 (IL4)    04657 IL-17 signaling pathway     123790366 (IL4)    04664 Fc epsilon RI signaling pathway     123790366 (IL4)    04672 Intestinal immune network for IgA production     123790366 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123790366 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     123790366 (IL4)   09163 Immune disease    05310 Asthma     123790366 (IL4)    05320 Autoimmune thyroid disease     123790366 (IL4)    05321 Inflammatory bowel disease     123790366 (IL4)    05330 Allograft rejection     123790366 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123790366 (IL4)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123790366 (IL4) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123790366 (IL4) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Cytokines    123790366 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  123790366 NCBI-ProteinID:  XP_045650688 UniProt:  A0A452QK50 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MGLTSQLIPALVCLLALTSTFVHGHNFNITIKEIIKTLNILTARNDTCMELTVTNIFTAP KNTTDTETFCRATTVLRQLSTHSCSNKLLGGLHRNLKTMANMTCSVNEVKKSTLRDFLER LKAIVQRKYYRH NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccagctctggtctgcttactagcactcaccagcacc ttcgtccacggccataacttcaatattaccattaaagagatcatcaaaacgttgaacatc ctcacagcgagaaacgacacgtgcatggagctgaccgtcaccaacatcttcactgcccca aagaacacaaccgatacggaaaccttctgcagagccacaactgtgcttcggcagctctct acacacagctgctccaacaaactcctcggagggcttcacaggaacctcaagacaatggca aacatgacctgttcggtgaatgaagtcaagaagagtacgctgagagacttcttggaaagg ctaaaagcgatcgtgcaaaggaaatactacaggcactga

DBGET integrated database retrieval system