Ursus americanus (American black bear): 123792132 Help Entry 123792132         CDS       T07931                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism uar  Ursus americanus (American black bear) Pathway uar01522   Endocrine resistance uar01524   Platinum drug resistance uar04010   MAPK signaling pathway uar04071   Sphingolipid signaling pathway uar04110   Cell cycle uar04115   p53 signaling pathway uar04137   Mitophagy - animal uar04151   PI3K-Akt signaling pathway uar04210   Apoptosis uar04211   Longevity regulating pathway uar04216   Ferroptosis uar04218   Cellular senescence uar04310   Wnt signaling pathway uar04722   Neurotrophin signaling pathway uar04919   Thyroid hormone signaling pathway uar05012   Parkinson disease uar05014   Amyotrophic lateral sclerosis uar05016   Huntington disease uar05160   Hepatitis C uar05161   Hepatitis B uar05162   Measles uar05163   Human cytomegalovirus infection uar05165   Human papillomavirus infection uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05168   Herpes simplex virus 1 infection uar05169   Epstein-Barr virus infection uar05200   Pathways in cancer uar05202   Transcriptional misregulation in cancer uar05203   Viral carcinogenesis uar05205   Proteoglycans in cancer uar05206   MicroRNAs in cancer uar05210   Colorectal cancer uar05212   Pancreatic cancer uar05213   Endometrial cancer uar05214   Glioma uar05215   Prostate cancer uar05216   Thyroid cancer uar05217   Basal cell carcinoma uar05218   Melanoma uar05219   Bladder cancer uar05220   Chronic myeloid leukemia uar05222   Small cell lung cancer uar05223   Non-small cell lung cancer uar05224   Breast cancer uar05225   Hepatocellular carcinoma uar05226   Gastric cancer uar05230   Central carbon metabolism in cancer uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123792132 (TP53)    04310 Wnt signaling pathway     123792132 (TP53)    04071 Sphingolipid signaling pathway     123792132 (TP53)    04151 PI3K-Akt signaling pathway     123792132 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     123792132 (TP53)   09143 Cell growth and death    04110 Cell cycle     123792132 (TP53)    04210 Apoptosis     123792132 (TP53)    04216 Ferroptosis     123792132 (TP53)    04115 p53 signaling pathway     123792132 (TP53)    04218 Cellular senescence     123792132 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     123792132 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     123792132 (TP53)   09149 Aging    04211 Longevity regulating pathway     123792132 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123792132 (TP53)    05202 Transcriptional misregulation in cancer     123792132 (TP53)    05206 MicroRNAs in cancer     123792132 (TP53)    05205 Proteoglycans in cancer     123792132 (TP53)    05203 Viral carcinogenesis     123792132 (TP53)    05230 Central carbon metabolism in cancer     123792132 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     123792132 (TP53)    05212 Pancreatic cancer     123792132 (TP53)    05225 Hepatocellular carcinoma     123792132 (TP53)    05226 Gastric cancer     123792132 (TP53)    05214 Glioma     123792132 (TP53)    05216 Thyroid cancer     123792132 (TP53)    05220 Chronic myeloid leukemia     123792132 (TP53)    05217 Basal cell carcinoma     123792132 (TP53)    05218 Melanoma     123792132 (TP53)    05219 Bladder cancer     123792132 (TP53)    05215 Prostate cancer     123792132 (TP53)    05213 Endometrial cancer     123792132 (TP53)    05224 Breast cancer     123792132 (TP53)    05222 Small cell lung cancer     123792132 (TP53)    05223 Non-small cell lung cancer     123792132 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123792132 (TP53)    05161 Hepatitis B     123792132 (TP53)    05160 Hepatitis C     123792132 (TP53)    05162 Measles     123792132 (TP53)    05168 Herpes simplex virus 1 infection     123792132 (TP53)    05163 Human cytomegalovirus infection     123792132 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     123792132 (TP53)    05169 Epstein-Barr virus infection     123792132 (TP53)    05165 Human papillomavirus infection     123792132 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     123792132 (TP53)    05014 Amyotrophic lateral sclerosis     123792132 (TP53)    05016 Huntington disease     123792132 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123792132 (TP53)    05418 Fluid shear stress and atherosclerosis     123792132 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     123792132 (TP53)    01522 Endocrine resistance     123792132 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uar03000]     123792132 (TP53)    03036 Chromosome and associated proteins [BR:uar03036]     123792132 (TP53)    03400 DNA repair and recombination proteins [BR:uar03400]     123792132 (TP53) Transcription factors [BR:uar03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     123792132 (TP53) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      123792132 (TP53) DNA repair and recombination proteins [BR:uar03400]  Eukaryotic type   Check point factors    Other check point factors     123792132 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  123792132 NCBI-ProteinID:  XP_045653296 UniProt:  A0A452QA33 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPGMDELLLSEGVVNWMDEGSDDT PRMPVAPAPAAPGPAISWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL FCQLAKTCPVQLWVNSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCSDGSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL TIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGESSPEPPPGSTKRALPPST SCSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK KGQSTSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgcaggacccgcagtcggagctcaccatcgacccccctctgagccaggagacattttcc gaattgtggaatctgcttcctgaaaacaatgttctgtcttccgagctgtccccaggaatg gatgaactgctgctctcagaaggcgtcgtgaactggatggacgaaggttcagatgacact cccaggatgccagtggctcccgcccctgcggcccctggaccagccatctcctggcccctg tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtctggggttc ctgcattccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctg ttttgccagctggcaaagacctgccctgtgcagctgtgggtcaactccccgcccccaccc gacacctgtgtccgcgccatggccatttataagaagtcggagttcgtgacagaggttgtg cggcgctgtccccaccacgagcgctgctctgatggtagtgatgggctggccccgcctcag catctcatccgggtggaaggaaacttgcgtgccaagtacttggacgacagaaacactttc cgacatagcgtggtggtgccctatgagccgcccgaggtcggctctgactgtaccacagtc cactataactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc accatcatcaccctggaagattccagtggtaatgttctcggacggagcagctttgaggta cgcgtctgtgcctgtcctgggagagaccggcgcacagaggaggagaatttccgtaagaag ggggagtcttcccccgagccgccccccggaagcactaagcgagcactgcctcccagcacc agctgctctcccccacaaaagaagaagccactggatggggaatatttcacccttcagatc cgtgggcgtgaacgcttcaatatgttcagggagctgaatgaggccttggagctgaaggat gccctgagtggcaaggagccaggggggagcagggctcactccagccacctgaaggctaag aaggggcagtctacctcccgccataaaaagctgatgttcaagagagagggacccgactca gactga

DBGET integrated database retrieval system