Ursus americanus (American black bear): 123798968 Help Entry 123798968         CDS       T07931                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism uar  Ursus americanus (American black bear) Pathway uar01522   Endocrine resistance uar04010   MAPK signaling pathway uar04024   cAMP signaling pathway uar04210   Apoptosis uar04380   Osteoclast differentiation uar04620   Toll-like receptor signaling pathway uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04662   B cell receptor signaling pathway uar04668   TNF signaling pathway uar04713   Circadian entrainment uar04725   Cholinergic synapse uar04728   Dopaminergic synapse uar04915   Estrogen signaling pathway uar04917   Prolactin signaling pathway uar04921   Oxytocin signaling pathway uar04926   Relaxin signaling pathway uar04928   Parathyroid hormone synthesis, secretion and action uar04932   Non-alcoholic fatty liver disease uar04935   Growth hormone synthesis, secretion and action uar05031   Amphetamine addiction uar05132   Salmonella infection uar05133   Pertussis uar05135   Yersinia infection uar05140   Leishmaniasis uar05142   Chagas disease uar05161   Hepatitis B uar05162   Measles uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05170   Human immunodeficiency virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05207   Chemical carcinogenesis - receptor activation uar05208   Chemical carcinogenesis - reactive oxygen species uar05210   Colorectal cancer uar05224   Breast cancer uar05231   Choline metabolism in cancer uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05323   Rheumatoid arthritis uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123798968 (FOS)    04668 TNF signaling pathway     123798968 (FOS)    04024 cAMP signaling pathway     123798968 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     123798968 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123798968 (FOS)    04660 T cell receptor signaling pathway     123798968 (FOS)    04658 Th1 and Th2 cell differentiation     123798968 (FOS)    04659 Th17 cell differentiation     123798968 (FOS)    04657 IL-17 signaling pathway     123798968 (FOS)    04662 B cell receptor signaling pathway     123798968 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     123798968 (FOS)    04917 Prolactin signaling pathway     123798968 (FOS)    04921 Oxytocin signaling pathway     123798968 (FOS)    04926 Relaxin signaling pathway     123798968 (FOS)    04935 Growth hormone synthesis, secretion and action     123798968 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     123798968 (FOS)   09156 Nervous system    04725 Cholinergic synapse     123798968 (FOS)    04728 Dopaminergic synapse     123798968 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     123798968 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     123798968 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123798968 (FOS)    05207 Chemical carcinogenesis - receptor activation     123798968 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     123798968 (FOS)    05231 Choline metabolism in cancer     123798968 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123798968 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     123798968 (FOS)    05224 Breast cancer     123798968 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123798968 (FOS)    05170 Human immunodeficiency virus 1 infection     123798968 (FOS)    05161 Hepatitis B     123798968 (FOS)    05171 Coronavirus disease - COVID-19     123798968 (FOS)    05162 Measles     123798968 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     123798968 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     123798968 (FOS)    05135 Yersinia infection     123798968 (FOS)    05133 Pertussis     123798968 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     123798968 (FOS)    05142 Chagas disease     123798968 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     123798968 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     123798968 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123798968 (FOS)    05418 Fluid shear stress and atherosclerosis     123798968 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     123798968 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     123798968 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uar03000]     123798968 (FOS)    04131 Membrane trafficking [BR:uar04131]     123798968 (FOS) Transcription factors [BR:uar03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     123798968 (FOS) Membrane trafficking [BR:uar04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     123798968 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  123798968 NCBI-ProteinID:  XP_045663744 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLSDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttt atcccgacggtgactgccatctccaccagcccggacctgcagtggttggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccctacc ccctccgctggggcttactccagggctggagtcgtgaagaccatgacgggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccggaggagggag ctgactgacactctccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacttgctgaaggagaaggaaaaactagagttcatcctggcggctcac cgacctgcctgcaagatccccgacgacctgggcttccccgaagagatgtctgtggcttcc ctagatctgagcgggggcctgcccgaagccgccacccccgagtccgaggaggctttcacc ctgcccctcctcagtgatcctgagcccaagccctccgtggagcccgtcaagagcatcagc agcatggagctgaaggccgagcccttcgatgacttcctgttcccagcgtcgtccaggccc agcggctccgagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca gcggactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gagcctctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag ggcagcagcagcaacgaaccgtcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system