Ursus americanus (American black bear): 123800635 Help Entry 123800635         CDS       T07931                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism uar  Ursus americanus (American black bear) Pathway uar03083   Polycomb repressive complex uar04010   MAPK signaling pathway uar05200   Pathways in cancer uar05202   Transcriptional misregulation in cancer uar05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     123800635 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123800635 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123800635 (MAX)    05202 Transcriptional misregulation in cancer     123800635 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     123800635 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uar03000]     123800635 (MAX)    03036 Chromosome and associated proteins [BR:uar03036]     123800635 (MAX) Transcription factors [BR:uar03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     123800635 (MAX) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      123800635 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 DUF7801 GAGA_bind Csm1_N Motif Other DBs NCBI-GeneID:  123800635 NCBI-ProteinID:  XP_045666373 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS DNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaagcaacaggca tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac cacacacaccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaa gtccgtgcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctca gacaacagcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggctcg gactccagctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggag gccagctaa

DBGET integrated database retrieval system