Ursus maritimus (polar bear): 103656863 Help Entry 103656863         CDS       T03271                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04024   cAMP signaling pathway umr04062   Chemokine signaling pathway umr04510   Focal adhesion umr04517   IgSF CAM signaling umr04520   Adherens junction umr04611   Platelet activation umr04670   Leukocyte transendothelial migration umr04720   Long-term potentiation umr04722   Neurotrophin signaling pathway umr04934   Cushing syndrome umr04972   Pancreatic secretion umr05211   Renal cell carcinoma umr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103656863 (RAP1B)    04014 Ras signaling pathway     103656863 (RAP1B)    04015 Rap1 signaling pathway     103656863 (RAP1B)    04024 cAMP signaling pathway     103656863 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103656863 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103656863 (RAP1B)    04520 Adherens junction     103656863 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103656863 (RAP1B)    04670 Leukocyte transendothelial migration     103656863 (RAP1B)    04062 Chemokine signaling pathway     103656863 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     103656863 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     103656863 (RAP1B)    04722 Neurotrophin signaling pathway     103656863 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     103656863 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103656863 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103656863 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103656863 (RAP1B)    04031 GTP-binding proteins [BR:umr04031]     103656863 (RAP1B) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103656863 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    103656863 (RAP1B)   Exosomal proteins of colorectal cancer cells    103656863 (RAP1B) GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     103656863 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 Motif Other DBs NCBI-GeneID:  103656863 NCBI-ProteinID:  XP_040493174 UniProt:  A0A384BJM5 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKIRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataaactagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttac agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagacttatacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagatccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system