Ursus maritimus (polar bear): 103656903 Help Entry 103656903         CDS       T03271                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism umr  Ursus maritimus (polar bear) Pathway umr00510   N-Glycan biosynthesis umr00513   Various types of N-glycan biosynthesis umr04141   Protein processing in endoplasmic reticulum Module umr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:umr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     103656903    00513 Various types of N-glycan biosynthesis     103656903  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103656903 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  103656903 NCBI-ProteinID:  XP_040492991 UniProt:  A0A8M1GBG3 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MELEIMSRYTNPVNLAVFPHPTMVLLATGMFFTAWFFVYEVTSTKCTQDIYKELLISLVA LLFVSSRVLFLLLFLLFQPGSFTEFML NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggagctcgagatcatgagcagatacactaacccagtgaacctggctgtcttcccccat ccaaccatggtgctattggccactggcatgttctttacagcctggttcttcgtttatgag gttacttccaccaagtgcactcaggatatctacaaagagctcctaatctccttggtggcc ttgctcttcgtgagctctagagtcctcttcctgctactcttcctgctgttccaaccaggc agcttcactgaattcatgctttag

DBGET integrated database retrieval system