Ursus maritimus (polar bear): 103665813 Help Entry 103665813         CDS       T03271                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism umr  Ursus maritimus (polar bear) Pathway umr03082   ATP-dependent chromatin remodeling umr04015   Rap1 signaling pathway umr04145   Phagosome umr04210   Apoptosis umr04390   Hippo signaling pathway umr04510   Focal adhesion umr04520   Adherens junction umr04530   Tight junction umr04611   Platelet activation umr04613   Neutrophil extracellular trap formation umr04670   Leukocyte transendothelial migration umr04714   Thermogenesis umr04810   Regulation of actin cytoskeleton umr04814   Motor proteins umr04820   Cytoskeleton in muscle cells umr04919   Thyroid hormone signaling pathway umr04921   Oxytocin signaling pathway umr04971   Gastric acid secretion umr05014   Amyotrophic lateral sclerosis umr05100   Bacterial invasion of epithelial cells umr05132   Salmonella infection umr05135   Yersinia infection umr05164   Influenza A umr05205   Proteoglycans in cancer umr05225   Hepatocellular carcinoma umr05410   Hypertrophic cardiomyopathy umr05412   Arrhythmogenic right ventricular cardiomyopathy umr05414   Dilated cardiomyopathy umr05416   Viral myocarditis umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103665813 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103665813 (ACTG1)    04390 Hippo signaling pathway     103665813 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103665813 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     103665813 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103665813 (ACTG1)    04520 Adherens junction     103665813 (ACTG1)    04530 Tight junction     103665813 (ACTG1)   09142 Cell motility    04814 Motor proteins     103665813 (ACTG1)    04820 Cytoskeleton in muscle cells     103665813 (ACTG1)    04810 Regulation of actin cytoskeleton     103665813 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103665813 (ACTG1)    04613 Neutrophil extracellular trap formation     103665813 (ACTG1)    04670 Leukocyte transendothelial migration     103665813 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     103665813 (ACTG1)    04919 Thyroid hormone signaling pathway     103665813 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     103665813 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     103665813 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103665813 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103665813 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     103665813 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     103665813 (ACTG1)    05135 Yersinia infection     103665813 (ACTG1)    05100 Bacterial invasion of epithelial cells     103665813 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103665813 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103665813 (ACTG1)    05410 Hypertrophic cardiomyopathy     103665813 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     103665813 (ACTG1)    05414 Dilated cardiomyopathy     103665813 (ACTG1)    05416 Viral myocarditis     103665813 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:umr03021]     103665813 (ACTG1)    03019 Messenger RNA biogenesis [BR:umr03019]     103665813 (ACTG1)    03036 Chromosome and associated proteins [BR:umr03036]     103665813 (ACTG1)    03029 Mitochondrial biogenesis [BR:umr03029]     103665813 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:umr04812]     103665813 (ACTG1)    04147 Exosome [BR:umr04147]     103665813 (ACTG1) Transcription machinery [BR:umr03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      103665813 (ACTG1) Messenger RNA biogenesis [BR:umr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103665813 (ACTG1) Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      103665813 (ACTG1)     NuA4 complex      103665813 (ACTG1)   Chromatin remodeling factors    BAF complex     103665813 (ACTG1)    PBAF complex     103665813 (ACTG1)    GBAF(ncBAF) complex     103665813 (ACTG1)    SWR1 complex     103665813 (ACTG1) Mitochondrial biogenesis [BR:umr03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     103665813 (ACTG1) Cytoskeleton proteins [BR:umr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      103665813 (ACTG1) Exosome [BR:umr04147]  Exosomal proteins   Proteins found in most exosomes    103665813 (ACTG1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  103665813 NCBI-ProteinID:  XP_040495963 UniProt:  A0A452UJW1 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaggagatcgccgcgctcgttatcgacaatggctccggcatgtgcaaggcgggc tttgctggggatgacgccccccgagccgtgtttccgtccatcgtcgggcgaccccgacac cagggcgtgatggtgggtatgggccagaaggactcgtacgtgggcgacgaggcccagagc aagcgcggcatcctgaccctcaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccataccttctacaacgagctgcgcgtggcccccgaggag caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgact cagatcatgttcgagaccttcaacaccccagccatgtatgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccactggtattgtcatggactctggggacggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgtggctacagcttc accaccaccgccgagcgggaaatcgtgcgtgacatcaaagagaagctgtgctacgtcgcc ctggacttcgagcaggagatggccacggccgcatcgtcctcctccctggagaagagctat gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgcccagaggcg ctcttccagccctccttcttggggatggagtcctgtggtatccacgagaccactttcaac tccatcatgaagtgtgacgtcgacatccgcaaggacctctacgccaacacggtgctgtcc ggtgggaccaccatgtaccccggcatcgccgacaggatgcagaaggagatcacagccctg gcgcccagcacgatgaagatcaagatcatcgctcctcctgagcgcaagtactcggtgtgg atcgggggctccatcctggcctcactgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system