Ursus maritimus (polar bear): 103672194 Help Entry 103672194         CDS       T03271                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism umr  Ursus maritimus (polar bear) Pathway umr03083   Polycomb repressive complex umr04010   MAPK signaling pathway umr05200   Pathways in cancer umr05202   Transcriptional misregulation in cancer umr05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     103672194 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103672194 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103672194 (MAX)    05202 Transcriptional misregulation in cancer     103672194 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     103672194 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:umr03000]     103672194 (MAX)    03036 Chromosome and associated proteins [BR:umr03036]     103672194 (MAX) Transcription factors [BR:umr03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     103672194 (MAX) Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      103672194 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA bZIP_2 SlyX Jnk-SapK_ap_N DUF5595 SLX9 GAGA_bind Csm1_N Motif Other DBs NCBI-GeneID:  103672194 NCBI-ProteinID:  XP_040497716 UniProt:  A0A8M1GPS5 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS DNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaagcaacaggca tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac cacacacaccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaa gtccgtgcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctca gacaacagcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggctcg gactccagctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggag gccagctaa

DBGET integrated database retrieval system