Ursus maritimus (polar bear): 103678328 Help Entry 103678328         CDS       T03271                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism umr  Ursus maritimus (polar bear) Pathway umr00564   Glycerophospholipid metabolism umr00565   Ether lipid metabolism umr00590   Arachidonic acid metabolism umr00591   Linoleic acid metabolism umr00592   alpha-Linolenic acid metabolism umr01100   Metabolic pathways umr04014   Ras signaling pathway umr04270   Vascular smooth muscle contraction umr04972   Pancreatic secretion umr04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:umr00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     103678328 (PLA2G1B)    00565 Ether lipid metabolism     103678328 (PLA2G1B)    00590 Arachidonic acid metabolism     103678328 (PLA2G1B)    00591 Linoleic acid metabolism     103678328 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     103678328 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103678328 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     103678328 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     103678328 (PLA2G1B)    04975 Fat digestion and absorption     103678328 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103678328 (PLA2G1B) Enzymes [BR:umr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      103678328 (PLA2G1B) Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     103678328 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Phospholip_A2_2 Motif Other DBs NCBI-GeneID:  103678328 NCBI-ProteinID:  XP_008705901 UniProt:  A0A384DFY4 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MKFLVLAALLTVAAADGGISPRAVWQFRSMIKCTIPGSDPLKDYNNYGCYCGLGGSGTPV DELDKCCQTHDNCYSEAKKLDSCKFLLDNPYTNTYSYSCSGSEITCSEKNKACEAFVCNC DRSAAICFSKAPYNKENKNLDTKKYCKD NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaaatttcttgtactggctgctctcctcacagtggccgctgccgatgggggcatcagc ccgcgggcagtgtggcagttccgcagcatgatcaagtgcactatccccgggagtgatccc ctgaaggactacaacaactacggctgctactgtggcctgggtggatccggcacccctgtg gatgaactggacaagtgttgccagacccacgacaactgctactcagaagccaagaaactg gacagctgtaaattcctcctggataacccctacaccaatacctactcatactcgtgctct ggctctgagatcacctgcagcgaaaaaaacaaagcctgtgaggctttcgtctgcaactgt gaccgcagtgctgccatctgcttttcaaaggccccatataacaaggagaacaagaatctt gacaccaagaagtactgtaaggattga

DBGET integrated database retrieval system