Ursus maritimus (polar bear): 103679584 Help Entry 103679584         CDS       T03271                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism umr  Ursus maritimus (polar bear) Pathway umr01523   Antifolate resistance umr04010   MAPK signaling pathway umr04014   Ras signaling pathway umr04024   cAMP signaling pathway umr04062   Chemokine signaling pathway umr04064   NF-kappa B signaling pathway umr04066   HIF-1 signaling pathway umr04071   Sphingolipid signaling pathway umr04137   Mitophagy - animal umr04151   PI3K-Akt signaling pathway umr04210   Apoptosis umr04211   Longevity regulating pathway umr04218   Cellular senescence umr04380   Osteoclast differentiation umr04613   Neutrophil extracellular trap formation umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04623   Cytosolic DNA-sensing pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04662   B cell receptor signaling pathway umr04668   TNF signaling pathway umr04722   Neurotrophin signaling pathway umr04917   Prolactin signaling pathway umr04920   Adipocytokine signaling pathway umr04926   Relaxin signaling pathway umr04931   Insulin resistance umr04932   Non-alcoholic fatty liver disease umr04933   AGE-RAGE signaling pathway in diabetic complications umr04936   Alcoholic liver disease umr05010   Alzheimer disease umr05022   Pathways of neurodegeneration - multiple diseases umr05030   Cocaine addiction umr05132   Salmonella infection umr05133   Pertussis umr05134   Legionellosis umr05135   Yersinia infection umr05140   Leishmaniasis umr05142   Chagas disease umr05145   Toxoplasmosis umr05146   Amoebiasis umr05152   Tuberculosis umr05160   Hepatitis C umr05161   Hepatitis B umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05165   Human papillomavirus infection umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05168   Herpes simplex virus 1 infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05202   Transcriptional misregulation in cancer umr05203   Viral carcinogenesis umr05207   Chemical carcinogenesis - receptor activation umr05208   Chemical carcinogenesis - reactive oxygen species umr05212   Pancreatic cancer umr05215   Prostate cancer umr05220   Chronic myeloid leukemia umr05221   Acute myeloid leukemia umr05222   Small cell lung cancer umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05321   Inflammatory bowel disease umr05415   Diabetic cardiomyopathy umr05417   Lipid and atherosclerosis umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103679584 (RELA)    04014 Ras signaling pathway     103679584 (RELA)    04064 NF-kappa B signaling pathway     103679584 (RELA)    04668 TNF signaling pathway     103679584 (RELA)    04066 HIF-1 signaling pathway     103679584 (RELA)    04071 Sphingolipid signaling pathway     103679584 (RELA)    04024 cAMP signaling pathway     103679584 (RELA)    04151 PI3K-Akt signaling pathway     103679584 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103679584 (RELA)   09143 Cell growth and death    04210 Apoptosis     103679584 (RELA)    04218 Cellular senescence     103679584 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103679584 (RELA)    04620 Toll-like receptor signaling pathway     103679584 (RELA)    04621 NOD-like receptor signaling pathway     103679584 (RELA)    04622 RIG-I-like receptor signaling pathway     103679584 (RELA)    04623 Cytosolic DNA-sensing pathway     103679584 (RELA)    04625 C-type lectin receptor signaling pathway     103679584 (RELA)    04660 T cell receptor signaling pathway     103679584 (RELA)    04658 Th1 and Th2 cell differentiation     103679584 (RELA)    04659 Th17 cell differentiation     103679584 (RELA)    04657 IL-17 signaling pathway     103679584 (RELA)    04662 B cell receptor signaling pathway     103679584 (RELA)    04062 Chemokine signaling pathway     103679584 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103679584 (RELA)    04917 Prolactin signaling pathway     103679584 (RELA)    04926 Relaxin signaling pathway     103679584 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103679584 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     103679584 (RELA)   09149 Aging    04211 Longevity regulating pathway     103679584 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103679584 (RELA)    05202 Transcriptional misregulation in cancer     103679584 (RELA)    05207 Chemical carcinogenesis - receptor activation     103679584 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     103679584 (RELA)    05203 Viral carcinogenesis     103679584 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103679584 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     103679584 (RELA)    05221 Acute myeloid leukemia     103679584 (RELA)    05220 Chronic myeloid leukemia     103679584 (RELA)    05215 Prostate cancer     103679584 (RELA)    05222 Small cell lung cancer     103679584 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103679584 (RELA)    05170 Human immunodeficiency virus 1 infection     103679584 (RELA)    05161 Hepatitis B     103679584 (RELA)    05160 Hepatitis C     103679584 (RELA)    05171 Coronavirus disease - COVID-19     103679584 (RELA)    05164 Influenza A     103679584 (RELA)    05162 Measles     103679584 (RELA)    05168 Herpes simplex virus 1 infection     103679584 (RELA)    05163 Human cytomegalovirus infection     103679584 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     103679584 (RELA)    05169 Epstein-Barr virus infection     103679584 (RELA)    05165 Human papillomavirus infection     103679584 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103679584 (RELA)    05135 Yersinia infection     103679584 (RELA)    05133 Pertussis     103679584 (RELA)    05134 Legionellosis     103679584 (RELA)    05152 Tuberculosis     103679584 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     103679584 (RELA)    05145 Toxoplasmosis     103679584 (RELA)    05140 Leishmaniasis     103679584 (RELA)    05142 Chagas disease     103679584 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     103679584 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     103679584 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     103679584 (RELA)   09165 Substance dependence    05030 Cocaine addiction     103679584 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103679584 (RELA)    05418 Fluid shear stress and atherosclerosis     103679584 (RELA)    05415 Diabetic cardiomyopathy     103679584 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103679584 (RELA)    04932 Non-alcoholic fatty liver disease     103679584 (RELA)    04931 Insulin resistance     103679584 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     103679584 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103679584 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:umr03000]     103679584 (RELA) Transcription factors [BR:umr03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     103679584 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  103679584 NCBI-ProteinID:  XP_040495345 UniProt:  A0A8M1GK39 LinkDB All DBs Position Unknown AA seq 539 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTPSVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPNQTSALAPAPAPILAQAPAPAPAPILAPGLAQAVVPPAPKTTQAGE GTLSEALLHLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPM LMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgtctgagcccgcccaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcagcgggcagtatcccgggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacactgggccagggacagttcgcatctccctggttaccaaggac ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat gaggctgagctctgccccgaccgttgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc ttccaagttcccatcgaagaacagcgtggggactacgacctgaatgcggtgcggctgtgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cggaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaagtgtatttcacgggaccgggctgggaggcccgaggctccttttct caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgacaccgaattgaggag aaacgcaaaaggacgtatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccgacctccaccccggcgcattgctgtgccttcccgaagcacaccttcc gtccccaagccagctccccagccctatccctttacgccgtccctcagcaccatcaacttc gaggagttctcccccatggtctttccttcggggcagatcccaaaccagacctctgccttg gccccagcccctgccccaatcctcgcccaggccccggccccagcccctgccccgatctta gccccaggccttgctcaggctgtggtcccccccgcccccaagaccacccaggccggggaa gggacactgtcagaggccctgctgcacctgcagtttgacgccgacgaagacctgggggcc ctgctgggcaacagcactgaccccgccgtgttcacagacctggcatctgtcgacaactct gagtttcagcagctgctgaaccagggtgtatctgtggccccccacacagccgagcccatg ctgatggagtaccctgaggcaataacgcgcctggtgacagggtcccagaggccccctgac ccagctcctgctcccctgggggcctctgggctccccaacggcctcctctcaggggatgaa gacttctcctccattgcagacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system