Ursus maritimus (polar bear): 103681734 Help Entry 103681734         CDS       T03271                                  Symbol CD209 Name (RefSeq) CD209 antigen isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism umr  Ursus maritimus (polar bear) Pathway umr03260   Virion - Human immunodeficiency virus umr03264   Virion - Flavivirus and Alphavirus umr03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus umr03273   Virion - Lassa virus and SFTS virus umr04145   Phagosome umr04625   C-type lectin receptor signaling pathway umr05152   Tuberculosis umr05162   Measles Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     103681734 (CD209)    03264 Virion - Flavivirus and Alphavirus     103681734 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     103681734 (CD209)    03273 Virion - Lassa virus and SFTS virus     103681734 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103681734 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103681734 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     103681734 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     103681734 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103681734 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:umr04054]     103681734 (CD209)    04515 Cell adhesion molecules [BR:umr04515]     103681734 (CD209)    04090 CD molecules [BR:umr04090]     103681734 (CD209)    04091 Lectins [BR:umr04091]     103681734 (CD209) Membrane trafficking [BR:umr04131]  Endocytosis   Phagocytosis    C-lectin receptors     103681734 (CD209) Pattern recognition receptors [BR:umr04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    103681734 (CD209) Cell adhesion molecules [BR:umr04515]  Lectins   Selectins and C-type lectins    103681734 (CD209) CD molecules [BR:umr04090]  Proteins   103681734 (CD209) Lectins [BR:umr04091]  C-Type lectins   Asialoglycoprotein and DC receptors    103681734 (CD209) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  103681734 NCBI-ProteinID:  XP_008709536 UniProt:  A0A384DR49 LinkDB All DBs Position Unknown AA seq 249 aa AA seqDB search MAEMCDSKEPGDPEEEMFGGQKVTRKYPGLLRSSRSLSACLTRAQLPLLLLLISLGFFML LVATLVQVSRIHQSLQKETRDHQESPSQVGVSQEPTRSDLEDVLQQLTWMNATLAGLCRP CPWKWELFQGRCYFFSQTQDIWKDAISACQNLRAQLVVINSTEEQKFLKSWNVRNNQRTW IGLSDHHNEGSWKWVDSSPLQLSFWKEGEPNNHGDEDCVELYSNGWNDNRCNTENFWTCE KPSSSCPGS NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atggcagaaatgtgtgactccaaggagccgggggaccccgaggaggagatgtttgggggc cagaaagtgacgaggaaataccctggactgctcaggagctcaaggagcttgtcagcgtgt ctgacccgggcccagttgcctctgctgctgcttctcatctctttgggcttcttcatgctc ctggtggccaccctggttcaagtctccaggatccaccaatccctgcagaaagagacgcgg gaccatcaggagagccccagccaagtgggtgtttctcaggagccgacgcgatcagacctg gaggacgtcctccagcagctgacctggatgaatgccaccctggctggcctgtgccgcccc tgtccctggaaatgggaactcttccagggaagatgctacttcttctcccagacccaggac atctggaaagatgccatttccgcgtgtcagaacttgagggcccagctggtggtcatcaac agtactgaggagcagaaatttctgaagtcttggaatgtgagaaataaccagcgcacctgg atcggcctcagtgaccaccacaatgaggggtcctggaaatgggtggacagctctcccctg caactcagcttctggaaagaaggggaacccaacaaccacggggacgaggactgtgtagaa ttgtacagcaatggctggaatgataacagatgtaatacagaaaacttctggacgtgcgag aagccttcgtcctcctgccctggctcctga

DBGET integrated database retrieval system