Ursus maritimus (polar bear): 103681734 Help Entry 103681734         CDS       T03271                                  Symbol CD209 Name (RefSeq) CD209 antigen isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism umr  Ursus maritimus (polar bear) Pathway umr03260   Virion - Human immunodeficiency virus umr03264   Virion - Flavivirus and Alphavirus umr03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus umr03273   Virion - Lassa virus and SFTS virus umr04145   Phagosome umr04517   IgSF CAM signaling umr04625   C-type lectin receptor signaling pathway umr05152   Tuberculosis umr05162   Measles Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     103681734 (CD209)    03264 Virion - Flavivirus and Alphavirus     103681734 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     103681734 (CD209)    03273 Virion - Lassa virus and SFTS virus     103681734 (CD209)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103681734 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103681734 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103681734 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     103681734 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     103681734 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103681734 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:umr04054]     103681734 (CD209)    04515 Cell adhesion molecules [BR:umr04515]     103681734 (CD209)    04090 CD molecules [BR:umr04090]     103681734 (CD209)    04091 Lectins [BR:umr04091]     103681734 (CD209) Membrane trafficking [BR:umr04131]  Endocytosis   Phagocytosis    C-lectin receptors     103681734 (CD209) Pattern recognition receptors [BR:umr04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    103681734 (CD209) Cell adhesion molecules [BR:umr04515]  Lectins   Selectins and C-type lectins    103681734 (CD209) CD molecules [BR:umr04090]  Proteins   103681734 (CD209) Lectins [BR:umr04091]  C-Type lectins   Asialoglycoprotein and DC receptors    103681734 (CD209) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  103681734 NCBI-ProteinID:  XP_008709536 UniProt:  A0A384DR49 LinkDB All DBs Position Unknown AA seq 249 aa AA seqDB search MAEMCDSKEPGDPEEEMFGGQKVTRKYPGLLRSSRSLSACLTRAQLPLLLLLISLGFFML LVATLVQVSRIHQSLQKETRDHQESPSQVGVSQEPTRSDLEDVLQQLTWMNATLAGLCRP CPWKWELFQGRCYFFSQTQDIWKDAISACQNLRAQLVVINSTEEQKFLKSWNVRNNQRTW IGLSDHHNEGSWKWVDSSPLQLSFWKEGEPNNHGDEDCVELYSNGWNDNRCNTENFWTCE KPSSSCPGS NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atggcagaaatgtgtgactccaaggagccgggggaccccgaggaggagatgtttgggggc cagaaagtgacgaggaaataccctggactgctcaggagctcaaggagcttgtcagcgtgt ctgacccgggcccagttgcctctgctgctgcttctcatctctttgggcttcttcatgctc ctggtggccaccctggttcaagtctccaggatccaccaatccctgcagaaagagacgcgg gaccatcaggagagccccagccaagtgggtgtttctcaggagccgacgcgatcagacctg gaggacgtcctccagcagctgacctggatgaatgccaccctggctggcctgtgccgcccc tgtccctggaaatgggaactcttccagggaagatgctacttcttctcccagacccaggac atctggaaagatgccatttccgcgtgtcagaacttgagggcccagctggtggtcatcaac agtactgaggagcagaaatttctgaagtcttggaatgtgagaaataaccagcgcacctgg atcggcctcagtgaccaccacaatgaggggtcctggaaatgggtggacagctctcccctg caactcagcttctggaaagaaggggaacccaacaaccacggggacgaggactgtgtagaa ttgtacagcaatggctggaatgataacagatgtaatacagaaaacttctggacgtgcgag aagccttcgtcctcctgccctggctcctga

DBGET integrated database retrieval system