Ursus maritimus (polar bear): 121101078 Help Entry 121101078         CDS       T03271                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism umr  Ursus maritimus (polar bear) Pathway umr00510   N-Glycan biosynthesis umr00513   Various types of N-glycan biosynthesis umr04141   Protein processing in endoplasmic reticulum Module umr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:umr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121101078    00513 Various types of N-glycan biosynthesis     121101078  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121101078 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  121101078 NCBI-ProteinID:  XP_040479657 UniProt:  A0A8M1FCQ0 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MSRYTSPVNPAVIPRLTMVLLAIGMFFTPWFFIYEVTSTKYTRDIYEELLISLVALLLMD FGVLFLLL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcagatacaccagcccagtgaaccctgctgtcatccctcgtctgaccatggttcta ttggccattggtatgttctttactccctggttctttatttatgaggttacctccactaag tacactcgggatatctatgaagagctcctcatctccttggtggccttgctcctcatggac tttggagtcctctttctgctgctctga

DBGET integrated database retrieval system