Undibacterium sp. KW1: UNDKW_2655 Help Entry UNDKW_2655        CDS       T08678                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism und  Undibacterium sp. KW1 Pathway und00670   One carbon pool by folate und00790   Folate biosynthesis und01100   Metabolic pathways und01240   Biosynthesis of cofactors und04981   Folate transport and metabolism Module und_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:und00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     UNDKW_2655 (folA)    00670 One carbon pool by folate     UNDKW_2655 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     UNDKW_2655 (folA) Enzymes [BR:und01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      UNDKW_2655 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 IMS Motif Other DBs NCBI-ProteinID:  BBB60928 UniProt:  A0A6N4T5K7 LinkDB All DBs Position 2946714..2947202 Genome browser AA seq 162 aa AA seqDB search MSMSSLSIIVATDSKLGIGIDNKLPWHLPEDLAHFKRTTTGHAIIMGRKTFESIGRPLPN RRNIVVTRNHEWQHAGVEAVASLDAARALLDQKLAFIIGGAEIYSQSMELANELVVTEIQ QEFACDAFFPVINPLIWKETGREKHFSKEKNLHFAFVTYKKI NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcatgtcatctttaagtattattgttgcaaccgactccaagctgggcatagggata gataataagctgccttggcatttgcctgaggatcttgcccactttaagcggaccaccact ggacacgccatcatcatgggcaggaaaacctttgaatccataggtcgccccttaccgaac aggcgcaatattgtcgtcacgcggaatcatgagtggcaacatgcaggggtggaagcagtg gcatcgctggatgcagcgcgggcgttgctggaccagaaattggctttcatcataggcgga gccgagatttacagccaaagcatggaattggccaatgaactggtcgtgaccgagatacaa caggagtttgcatgtgacgcttttttcccagtgatcaatccgctaatatggaaagagacg ggaagagaaaaacatttctccaaagaaaaaaatttacattttgcatttgtcacttacaaa aagatttag

DBGET integrated database retrieval system