Undibacterium sp. KW1: UNDKW_2695 Help Entry UNDKW_2695        CDS       T08678                                  Name (GenBank) hypothetical protein   KO K01737   6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50] Organism und  Undibacterium sp. KW1 Pathway und00790   Folate biosynthesis und01100   Metabolic pathways und01240   Biosynthesis of cofactors Module und_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:und00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     UNDKW_2695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:und03016]     UNDKW_2695 Enzymes [BR:und01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.50  6-carboxytetrahydropterin synthase      UNDKW_2695   4.2  Carbon-oxygen lyases    4.2.3  Acting on phosphates     4.2.3.12  6-pyruvoyltetrahydropterin synthase      UNDKW_2695 Transfer RNA biogenesis [BR:und03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     UNDKW_2695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTPS Motif Other DBs NCBI-ProteinID:  BBB60968 UniProt:  A0A6N4T5N9 LinkDB All DBs Position complement(2990901..2991185) Genome browser AA seq 94 aa AA seqDB search MDFGDIKALANEHLVNLWDHSFIVYEKDYIIKNFLEKLPGHKTVVIDRVPTVENLAKIAF DILKVVYHGRFGRALELTKVTLYETPNCWAEIDG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggattttggtgatatcaaggcgctcgctaacgagcatctggtcaatttgtgggatcat tccttcatcgtttacgagaaggattacatcatcaagaatttcctggagaaactgccagga cacaagacggtggtcattgatcgcgtgcctaccgtagaaaatctggccaagattgccttc gatattctgaaggtggtttatcacggcaggtttggccgcgctttggagttgaccaaagtc acgctgtatgaaacaccaaattgctgggctgagattgacggataa

DBGET integrated database retrieval system