Undibacterium sp. YM2: UNDYM_2727 Help Entry UNDYM_2727        CDS       T10101                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism uny  Undibacterium sp. YM2 Pathway uny00670   One carbon pool by folate uny00790   Folate biosynthesis uny01100   Metabolic pathways uny01240   Biosynthesis of cofactors uny04981   Folate transport and metabolism Module uny_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:uny00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     UNDYM_2727 (folA)    00670 One carbon pool by folate     UNDYM_2727 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     UNDYM_2727 (folA) Enzymes [BR:uny01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      UNDYM_2727 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 IMS Motif Other DBs NCBI-ProteinID:  BBB66980 LinkDB All DBs Position 3002893..3003381 Genome browser AA seq 162 aa AA seqDB search MSMSSLSIIVATDSKLGIGIDNKLPWHLPEDLAHFKRTTTGHAIIMGRKTFESIGRPLPN RRNIVVTRNHEWQHAGVEVVASLDAARALLDQELAFIIGGAEIYSQSMELANELVVTEIQ QEFACDAFFPVINPLIWKETGREKHFSKEKNLHFAFVTYKKI NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcatgtcatctttaagtattattgttgcaaccgactccaagctgggcatagggata gataataagctgccctggcatttgcctgaagatcttgcccactttaagcggaccaccact ggacacgccatcatcatgggcaggaaaacctttgaatccataggtcgccccttaccgaac aggcgcaatattgtcgtcacacggaatcatgagtggcaacatgcgggagtggaagtagtg gcttcactagatgcagcgcgggctttgctggaccaggaattggctttcatcataggcgga gccgagatttacagccaaagcatggaattggccaatgaactggtcgtgaccgagatacaa caggagtttgcatgtgatgcttttttcccagtgatcaatccgctaatatggaaagagacg ggaagagaaaaacatttctccaaagaaaaaaatttacattttgcatttgtcacttacaaa aagatttag

DBGET integrated database retrieval system