Vigna angularis (adzuki bean): 108338955 Help Entry 108338955         CDS       T04660                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism var  Vigna angularis (adzuki bean) Pathway var03420   Nucleotide excision repair var04120   Ubiquitin mediated proteolysis var04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:var00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108338955    04120 Ubiquitin mediated proteolysis     108338955   09124 Replication and repair    03420 Nucleotide excision repair     108338955  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:var04121]     108338955    03400 DNA repair and recombination proteins [BR:var03400]     108338955 Enzymes [BR:var01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108338955 Ubiquitin system [BR:var04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108338955   Multi subunit type E3    SCF complex     Ring finger protein      108338955    Cul2 complex      108338955    Cul3 complex      108338955    Cul4 complex      108338955    Cul7 complex      108338955    Cul8 complex      108338955    Cul9 complex      108338955 DNA repair and recombination proteins [BR:var03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108338955     TCR (transcription coupled repair) factors      Cul4-CSA complex       108338955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  108338955 NCBI-ProteinID:  XP_017431531 UniProt:  A0A0L9V5U2 LinkDB All DBs Position 5:complement(30095631..30098628) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMIPAGEASSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactcttgattccgacgtgccaatgattccggccggcgaggcatcgagcagcgcc ggaccgtcttccaagaagcccaagcgtttcgagatcaaaaagtggaacgcggtcgcactc tgggcttgggacatcgttgtcgataactgtgccatctgccggaaccacatcatggatcta tgcatcgagtgccaagccaaccaggccagcgcaactagcgaagaatgcacagtggcgtgg ggcgtttgtaaccatgcttttcacttccactgcattagtcgatggctcaagactcgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatacgggcactag

DBGET integrated database retrieval system