Venturia canescens: 122414880 Help Entry 122414880         CDS       T09386                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism vcan  Venturia canescens Pathway vcan03420   Nucleotide excision repair vcan04120   Ubiquitin mediated proteolysis vcan04141   Protein processing in endoplasmic reticulum vcan04310   Wnt signaling pathway vcan04341   Hedgehog signaling pathway - fly vcan04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:vcan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122414880    04120 Ubiquitin mediated proteolysis     122414880   09124 Replication and repair    03420 Nucleotide excision repair     122414880  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     122414880    04341 Hedgehog signaling pathway - fly     122414880    04350 TGF-beta signaling pathway     122414880  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vcan04121]     122414880    03400 DNA repair and recombination proteins [BR:vcan03400]     122414880 Enzymes [BR:vcan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122414880 Ubiquitin system [BR:vcan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122414880   Multi subunit type E3    SCF complex     Ring finger protein      122414880    Cul2 complex      122414880    Cul3 complex      122414880    Cul4 complex      122414880    Cul7 complex      122414880    Cul8 complex      122414880    Cul9 complex      122414880 DNA repair and recombination proteins [BR:vcan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122414880     TCR (transcription coupled repair) factors      Cul4-CSA complex       122414880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  122414880 NCBI-ProteinID:  XP_043282464 LinkDB All DBs Position 1:10487612..10490550 Genome browser AA seq 113 aa AA seqDB search MASAMDIDDEGSDLPTSGSTKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgtctgctatggatattgacgacgaaggcagtgatttacccacttcgggcagcaca aaaggcgataaaaagcgattcgaagtgaaaaagtggaatgccgttgctctctgggcttgg gatatcgtggttgacaactgcgcaatctgtaggaatcacataatggatctctgtatcgaa tgtcaggcgaatcaggcttcagcaacgagcgaagagtgcaccgtcgcttggggagtttgc aaccatgcattccatttccattgcatctcacgttggctcaagactaggcaagtctgtcca ctggacaaccgtgagtgggagttccaaaagtatgggcactaa

DBGET integrated database retrieval system