Vanessa cardui (painted lady): 124535169 Help Entry 124535169         CDS       T09161                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism vcd  Vanessa cardui (painted lady) Pathway vcd00510   N-Glycan biosynthesis vcd00513   Various types of N-glycan biosynthesis vcd04141   Protein processing in endoplasmic reticulum Module vcd_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:vcd00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     124535169    00513 Various types of N-glycan biosynthesis     124535169  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124535169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB CAAD Pox_E2-like Pestivirus_E2 Motif Other DBs NCBI-GeneID:  124535169 NCBI-ProteinID:  XP_046967223 LinkDB All DBs Position 14:complement(12869274..12869614) Genome browser AA seq 74 aa AA seqDB search MVRYASPINPAVFPHLTMLLLGIGIFFTAWFFVYEVTSTKSSRDLFKELLLSLVAALFSG FGILFLLLWVGIYV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggtgcgatacgcctcgcctatcaatccggcggtgttcccacatctaactatgctgctt cttggtatcggaatattctttacggcgtggttctttgtctacgaagtcacaagcacgaag tcgtcaagagacttgttcaaggaactcctgttatcactagtagccgccttgttctcaggc tttggtattctctttttattgttatgggtaggcatatacgtgtga

DBGET integrated database retrieval system