Vibrio cholerae O1 El Tor N16961: VC_0440 Help Entry VC_0440           CDS       T00034                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vch  Vibrio cholerae O1 El Tor N16961 Pathway vch00670   One carbon pool by folate vch00790   Folate biosynthesis vch01100   Metabolic pathways vch01240   Biosynthesis of cofactors vch04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:vch00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VC_0440    00670 One carbon pool by folate     VC_0440  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     VC_0440 Enzymes [BR:vch01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      VC_0440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAF93613 UniProt:  Q9KUS5 LinkDB All DBs Position I:469805..470302 Genome browser AA seq 165 aa AA seqDB search MMISMIAAMADQRIIGKDNQMPWHLPADFAWFKRCTLGKPVVMGRKTYQSIGRPLPGRHN IVISRDASLQIEGVDVVTSIEAALAKAGEVDEVMIIGGGSLYAACLPMAHKLYITEIHAK LDGDTQFPEWGSDWLERSREHYPADEKNAYGMDFVIFERQYPLPT NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgatgatcagtatgattgccgcgatggcagaccagcgcattattggtaaagataaccag atgccttggcatctaccggctgatttcgcgtggttcaaacgctgtacattaggtaagcct gtagtgatggggcgtaaaacctaccaatcgatcggacgtcctttaccggggcggcacaat attgtgatctcccgtgatgcgagtttgcagattgagggggtggatgtggtgacctccatt gaggcggcgctggcgaaagcgggtgaggtcgacgaggtgatgatcatcggaggtggtagc ttgtatgcggcctgtttgccgatggcccataaactgtatattaccgagatccatgcaaaa ttggatggtgatactcagtttcctgaatgggggagtgattggctagagcgctctcgtgag cattatcctgccgatgaaaaaaatgcctacgggatggattttgtgatttttgaacgccaa tatccccttcctacttga

DBGET integrated database retrieval system