Vibrio cholerae O1 M66-2: VCM66_0425 Help Entry VCM66_0425        CDS       T00891                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vcm  Vibrio cholerae O1 M66-2 Pathway vcm00670   One carbon pool by folate vcm00790   Folate biosynthesis vcm01100   Metabolic pathways vcm01240   Biosynthesis of cofactors vcm04981   Folate transport and metabolism Module vcm_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vcm00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VCM66_0425 (folA)    00670 One carbon pool by folate     VCM66_0425 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     VCM66_0425 (folA) Enzymes [BR:vcm01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      VCM66_0425 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ACP04751 UniProt:  C3LRH1 LinkDB All DBs Position I:454525..455022 Genome browser AA seq 165 aa AA seqDB search MMISMIAAMADQRIIGKDNQMPWHLPADFAWFKRCTLGKPVVMGRKTYQSIGRPLPGRHN IVISRDASLQIEGVDVVTSIEAALAKAGEVDEVMIIGGGSLYAACLPMAHKLYITEIHAK LDGDTQFPEWGSDWLERSREHYPADEKNAYGMDFVIFERQYPLPT NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgatgatcagtatgattgccgcgatggcagaccagcgcattattggtaaagataaccag atgccttggcatctaccggctgatttcgcgtggttcaaacgctgtacattaggtaagcct gtagtgatggggcgtaaaacctaccaatcgatcggacgtcctttaccggggcggcacaat attgtgatctcccgtgatgcgagtttgcagattgagggggtggatgtggtgacctccatt gaggcggcgctggcgaaagcgggtgaggtcgacgaggtgatgatcatcggaggtggtagc ttgtatgcggcctgtttgccgatggcccataaactgtatattaccgagatccatgcaaaa ttggatggtgatactcagtttcctgaatgggggagtgattggctagagcgctctcgtgag cattatcctgccgatgaaaaaaatgcctacgggatggattttgtgatttttgaacgccaa tatccccttcctacttga

DBGET integrated database retrieval system