Vibrio cholerae O1 El Tor MS6: MS6_0293 Help Entry MS6_0293          CDS       T03666                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vcs  Vibrio cholerae O1 El Tor MS6 Pathway vcs00670   One carbon pool by folate vcs00790   Folate biosynthesis vcs01100   Metabolic pathways vcs01240   Biosynthesis of cofactors vcs04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:vcs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MS6_0293    00670 One carbon pool by folate     MS6_0293  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     MS6_0293 Enzymes [BR:vcs01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      MS6_0293 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  BAP01948 LinkDB All DBs Position 1:346907..347404 Genome browser AA seq 165 aa AA seqDB search MMISMIAAMADQRIIGKDNQMPWHLPADFAWFKRCTLGKPVVMGRKTYQSIGRPLPGRHN IVISRDASLQIEGVDVVTSIEAALAKAGEVDEVMIIGGGSLYAACLPMAHKLYITEIHAK LDGDTQFPEWGSDWLERSREHYPADEKNAYGMDFVIFERQYPLPT NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgatgatcagtatgattgccgcgatggcagaccagcgcattattggtaaagataaccag atgccttggcatctaccggctgatttcgcgtggttcaaacgctgtacattaggtaagcct gtagtgatggggcgtaaaacctaccaatcgatcggacgtcctttaccggggcggcacaat attgtgatctcccgtgatgcgagtttgcagattgagggggtggatgtggtgacctccatt gaggcggcgctggcgaaagcgggtgaggtcgacgaggtgatgatcatcggaggtggtagc ttgtatgcggcctgtttgccgatggcccataaactgtatattaccgagatccatgcaaaa ttggatggtgatactcagtttcctgaatgggggagtgattggctagagcgctctcgtgag cattatcctgccgatgaaaaaaatgcctacgggatggattttgtgatttttgaacgccaa tatccccttcctacttga

DBGET integrated database retrieval system