Verticillium dahliae: VDAG_06301 Help Entry VDAG_06301        CDS       T03450                                  Name (RefSeq) RING-box protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism vda  Verticillium dahliae Pathway vda03420   Nucleotide excision repair vda04111   Cell cycle - yeast vda04120   Ubiquitin mediated proteolysis vda04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vda00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     VDAG_06301    04120 Ubiquitin mediated proteolysis     VDAG_06301   09124 Replication and repair    03420 Nucleotide excision repair     VDAG_06301  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     VDAG_06301  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vda04121]     VDAG_06301    03400 DNA repair and recombination proteins [BR:vda03400]     VDAG_06301 Enzymes [BR:vda01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      VDAG_06301 Ubiquitin system [BR:vda04121]  Ubiquitin ligases (E3)   UBL E3 ligases    VDAG_06301   Multi subunit type E3    SCF complex     Ring finger protein      VDAG_06301    Cul2 complex      VDAG_06301    Cul3 complex      VDAG_06301    Cul4 complex      VDAG_06301    Cul7 complex      VDAG_06301    Cul8 complex      VDAG_06301    Cul9 complex      VDAG_06301 DNA repair and recombination proteins [BR:vda03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       VDAG_06301     TCR (transcription coupled repair) factors      Cul4-CSA complex       VDAG_06301 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  20707764 NCBI-ProteinID:  XP_009656974 UniProt:  G2X743 LinkDB All DBs Position 8 AA seq 119 aa AA seqDB search MADVDMTDAPVQAVATKKPSGSEGKATDGKKRFEVKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccgacgtggacatgacggacgctcccgtccaggcagtcgctacgaagaaacccagc ggttcagagggaaaagccaccgatggaaagaagcgctttgaggtcaaaaagtggaatgct gttgcgttgtgggcttgggatattgttgtcgacaactgcgccatctgcagaaaccacatt atggatctttgtatcgagtgccaggccaaccaagcctcggcgaccagtgaagagtgcacc gtggcttggggaatatgcaaccacgccttccacttccattgcatatcgcgatggctcaag actcgacaagtatgccctctagataatcgtgactgggaatttcagaaatatggccgttaa

DBGET integrated database retrieval system