Vollenhovia emeryi: 105568857 Help Entry 105568857         CDS       T06016                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism vem  Vollenhovia emeryi Pathway vem03420   Nucleotide excision repair vem04120   Ubiquitin mediated proteolysis vem04141   Protein processing in endoplasmic reticulum vem04310   Wnt signaling pathway vem04341   Hedgehog signaling pathway - fly vem04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:vem00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105568857    04120 Ubiquitin mediated proteolysis     105568857   09124 Replication and repair    03420 Nucleotide excision repair     105568857  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105568857    04341 Hedgehog signaling pathway - fly     105568857    04350 TGF-beta signaling pathway     105568857  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vem04121]     105568857    03400 DNA repair and recombination proteins [BR:vem03400]     105568857 Enzymes [BR:vem01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105568857 Ubiquitin system [BR:vem04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105568857   Multi subunit type E3    SCF complex     Ring finger protein      105568857    Cul2 complex      105568857    Cul3 complex      105568857    Cul4 complex      105568857    Cul7 complex      105568857    Cul8 complex      105568857    Cul9 complex      105568857 DNA repair and recombination proteins [BR:vem03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105568857     TCR (transcription coupled repair) factors      Cul4-CSA complex       105568857 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  105568857 NCBI-ProteinID:  XP_011880241 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MATTMEIDDDECDLPTSSSGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaccatggagatcgacgatgacgagtgcgatctgccgacctccagcagcggc aaaggcgagaagaagcgcttcgaggtgaagaagtggaacgcggtggcactgtgggcctgg gatatcgtcgtggacaactgcgctatttgtcgcaatcacatcatggacctctgtatcgag tgccaagcgaaccaggcgtcggccaccagcgaggaatgtacggtagcgtggggcgtatgc aaccacgccttccattttcactgcatctcacgttggttgaagacacggcaggtctgccca ctggataatcgcgaatgggagtttcaaaaatatggacattaa

DBGET integrated database retrieval system