Aliivibrio fischeri MJ11: VFMJ11_0272 Help Entry VFMJ11_0272       CDS       T00754                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vfm  Aliivibrio fischeri MJ11 Pathway vfm00670   One carbon pool by folate vfm00790   Folate biosynthesis vfm01100   Metabolic pathways vfm01240   Biosynthesis of cofactors vfm04981   Folate transport and metabolism Module vfm_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vfm00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VFMJ11_0272 (folA)    00670 One carbon pool by folate     VFMJ11_0272 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     VFMJ11_0272 (folA) Enzymes [BR:vfm01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      VFMJ11_0272 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ACH64934 UniProt:  B5FGG3 LinkDB All DBs Position I:278375..278842 Genome browser AA seq 155 aa AA seqDB search MIAAMAKNRIIGIDNQMPWHLPADFAWFKRCTMGKPIVMGRKTYESIGRSLPGRLNIVLS RDANLQIDGVTCVTSIEEAKQAAGDIEELMIIGGGSIYQACLADADKLYLTFIDADIKGD TQFPDWGEGWDQTHSEMYPKDEKNQYDMEFVVLER NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgatagccgcaatggcaaagaatcgtattattggtattgataatcagatgccatggcat ttgcccgctgatttcgcttggtttaaaagatgcactatgggtaaacctattgtcatgggg cgtaagacttatgaatctattggtcgttcattaccgggtcgattgaatatcgtattaagc cgcgatgccaacttacaaatagacggagtgacttgcgttacttctattgaagaggctaaa caagccgctggtgatattgaagagctgatgattattggtggtggttcaatttatcaagcg tgtcttgctgatgcggataagctgtacctgacttttattgacgctgacattaagggcgat actcaattccctgattggggtgagggttgggatcagactcattctgaaatgtatccgaaa gatgaaaagaatcagtatgatatggagtttgtggttcttgaaaggtaa

DBGET integrated database retrieval system