KEGG   Viruses: 1489668
Entry
1489668           CDS       T40000                                 

Symbol
S, sars2
Name
(RefSeq) SARS coronavirus Tor2; spike glycoprotein
  KO
K24152  SARS coronavirus spike glycoprotein
Taxonomy
TAX:227984 [GN:T40069]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: CoV_S2 bCoV_S1_N bCoV_S1_RBD CoV_S1_C CoV_S2_C MukF_M Baculo_PEP_C DUF3418 DUF1664 SHE3 DUF4795 DUF2959 KxDL DUF16 TRPM_tetra
Other DBs
NCBI-GeneID: 1489668
NCBI-ProteinID: YP_009825051
RS: NC_004718
LinkDB
Structure
PDB: 
2BEZ 2BEQ 1ZV7 5X58 5X5B

Position
NC_004718:21492..25259
AA seq 1255 aa
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFL
PFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNS
TNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFK
HLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSP
AQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY
QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTF
FSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCV
LAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLND
YGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTP
SSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCAFGGVSVITPGTNASSEVAVLYQD
VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASY
HTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDC
NMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFG
GFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGL
TVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE
NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLN
DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSK
RVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFN
GTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKN
HTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL
GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgtttattttcttattatttcttactctcactagtggtagtgaccttgaccggtgcacc
acttttgatgatgttcaagctcctaattacactcaacatacttcatctatgaggggggtt
tactatcctgatgaaatttttagatcagacactctttatttaactcaggatttatttctt
ccattttattctaatgttacagggtttcatactattaatcatacgtttggcaaccctgtc
ataccttttaaggatggtatttattttgctgccacagagaaatcaaatgttgtccgtggt
tgggtttttggttctaccatgaacaacaagtcacagtcggtgattattattaacaattct
actaatgttgttatacgagcatgtaactttgaattgtgtgacaaccctttctttgctgtt
tctaaacccatgggtacacagacacatactatgatattcgataatgcatttaattgcact
ttcgagtacatatctgatgccttttcgcttgatgtttcagaaaagtcaggtaattttaaa
cacttacgagagtttgtgtttaaaaataaagatgggtttctctatgtttataagggctat
caacctatagatgtagttcgtgatctaccttctggttttaacactttgaaacctattttt
aagttgcctcttggtattaacattacaaattttagagccattcttacagccttttcacct
gctcaagacatttggggcacgtcagctgcagcctattttgttggctatttaaagccaact
acatttatgctcaagtatgatgaaaatggtacaatcacagatgctgttgattgttctcaa
aatccacttgctgaactcaaatgctctgttaagagctttgagattgacaaaggaatttac
cagacctctaatttcagggttgttccctcaggagatgttgtgagattccctaatattaca
aacttgtgtccttttggagaggtttttaatgctactaaattcccttctgtctatgcatgg
gagagaaaaaaaatttctaattgtgttgctgattactctgtgctctacaactcaacattt
ttttcaacctttaagtgctatggcgtttctgccactaagttgaatgatctttgcttctcc
aatgtctatgcagattcttttgtagtcaagggagatgatgtaagacaaatagcgccagga
caaactggtgttattgctgattataattataaattgccagatgatttcatgggttgtgtc
cttgcttggaatactaggaacattgatgctacttcaactggtaattataattataaatat
aggtatcttagacatggcaagcttaggccctttgagagagacatatctaatgtgcctttc
tcccctgatggcaaaccttgcaccccacctgctcttaattgttattggccattaaatgat
tatggtttttacaccactactggcattggctaccaaccttacagagttgtagtactttct
tttgaacttttaaatgcaccggccacggtttgtggaccaaaattatccactgaccttatt
aagaaccagtgtgtcaattttaattttaatggactcactggtactggtgtgttaactcct
tcttcaaagagatttcaaccatttcaacaatttggccgtgatgtttctgatttcactgat
tccgttcgagatcctaaaacatctgaaatattagacatttcaccttgcgcttttgggggt
gtaagtgtaattacacctggaacaaatgcttcatctgaagttgctgttctatatcaagat
gttaactgcactgatgtttctacagcaattcatgcagatcaactcacaccagcttggcgc
atatattctactggaaacaatgtattccagactcaagcaggctgtcttataggagctgag
catgtcgacacttcttatgagtgcgacattcctattggagctggcatttgtgctagttac
catacagtttctttattacgtagtactagccaaaaatctattgtggcttatactatgtct
ttaggtgctgatagttcaattgcttactctaataacaccattgctatacctactaacttt
tcaattagcattactacagaagtaatgcctgtttctatggctaaaacctccgtagattgt
aatatgtacatctgcggagattctactgaatgtgctaatttgcttctccaatatggtagc
ttttgcacacaactaaatcgtgcactctcaggtattgctgctgaacaggatcgcaacaca
cgtgaagtgttcgctcaagtcaaacaaatgtacaaaaccccaactttgaaatattttggt
ggttttaatttttcacaaatattacctgaccctctaaagccaactaagaggtcttttatt
gaggacttgctctttaataaggtgacactcgctgatgctggcttcatgaagcaatatggc
gaatgcctaggtgatattaatgctagagatctcatttgtgcgcagaagttcaatggactt
acagtgttgccacctctgctcactgatgatatgattgctgcctacactgctgctctagtt
agtggtactgccactgctggatggacatttggtgctggcgctgctcttcaaatacctttt
gctatgcaaatggcatataggttcaatggcattggagttacccaaaatgttctctatgag
aaccaaaaacaaatcgccaaccaatttaacaaggcgattagtcaaattcaagaatcactt
acaacaacatcaactgcattgggcaagctgcaagacgttgttaaccagaatgctcaagca
ttaaacacacttgttaaacaacttagctctaattttggtgcaatttcaagtgtgctaaat
gatatcctttcgcgacttgataaagtcgaggcggaggtacaaattgacaggttaattaca
ggcagacttcaaagccttcaaacctatgtaacacaacaactaatcagggctgctgaaatc
agggcttctgctaatcttgctgctactaaaatgtctgagtgtgttcttggacaatcaaaa
agagttgacttttgtggaaagggctaccaccttatgtccttcccacaagcagccccgcat
ggtgttgtcttcctacatgtcacgtatgtgccatcccaggagaggaacttcaccacagcg
ccagcaatttgtcatgaaggcaaagcatacttccctcgtgaaggtgtttttgtgtttaat
ggcacttcttggtttattacacagaggaacttcttttctccacaaataattactacagac
aatacatttgtctcaggaaattgtgatgtcgttattggcatcattaacaacacagtttat
gatcctctgcaacctgagcttgactcattcaaagaagagctggacaagtacttcaaaaat
catacatcaccagatgttgatcttggcgacatttcaggcattaacgcttctgtcgtcaac
attcaaaaagaaattgaccgcctcaatgaggtcgctaaaaatttaaatgaatcactcatt
gaccttcaagaattgggaaaatatgagcaatatattaaatggccttggtatgtttggctc
ggcttcattgctggactaattgccatcgtcatggttacaatcttgctttgttgcatgact
agttgttgcagttgcctcaagggtgcatgctcttgtggttcttgctgcaagtttgatgag
gatgactctgagccagttctcaagggtgtcaaattacattacacataa

DBGET integrated database retrieval system