KEGG   Viruses: 1489668
Entry
1489668           CDS       T40000                                 
Symbol
S, sars2
Name
(RefSeq) SARS coronavirus Tor2; spike glycoprotein
  KO
K24152  SARS coronavirus spike glycoprotein
Virus
227984  SARS coronavirus Tor2
SSDB
Motif
Pfam: CoV_S2 bCoV_S1_N bCoV_S1_RBD CoV_S1_C CoV_S2_C MukF_M Baculo_PEP_C DUF1664 DUF3418 SHE3 DUF2959 TRPM_tetra KxDL DUF16
Other DBs
NCBI-GeneID: 1489668
NCBI-ProteinID: YP_009825051
RS: NC_004718
LinkDB
Position
NC_004718:21492..25259
AA seq 1255 aa
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFL
PFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNS
TNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFK
HLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSP
AQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY
QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTF
FSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCV
LAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLND
YGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTP
SSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCAFGGVSVITPGTNASSEVAVLYQD
VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASY
HTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDC
NMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFG
GFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGL
TVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE
NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLN
DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSK
RVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFN
GTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKN
HTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL
GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgtttattttcttattatttcttactctcactagtggtagtgaccttgaccggtgcacc
acttttgatgatgttcaagctcctaattacactcaacatacttcatctatgaggggggtt
tactatcctgatgaaatttttagatcagacactctttatttaactcaggatttatttctt
ccattttattctaatgttacagggtttcatactattaatcatacgtttggcaaccctgtc
ataccttttaaggatggtatttattttgctgccacagagaaatcaaatgttgtccgtggt
tgggtttttggttctaccatgaacaacaagtcacagtcggtgattattattaacaattct
actaatgttgttatacgagcatgtaactttgaattgtgtgacaaccctttctttgctgtt
tctaaacccatgggtacacagacacatactatgatattcgataatgcatttaattgcact
ttcgagtacatatctgatgccttttcgcttgatgtttcagaaaagtcaggtaattttaaa
cacttacgagagtttgtgtttaaaaataaagatgggtttctctatgtttataagggctat
caacctatagatgtagttcgtgatctaccttctggttttaacactttgaaacctattttt
aagttgcctcttggtattaacattacaaattttagagccattcttacagccttttcacct
gctcaagacatttggggcacgtcagctgcagcctattttgttggctatttaaagccaact
acatttatgctcaagtatgatgaaaatggtacaatcacagatgctgttgattgttctcaa
aatccacttgctgaactcaaatgctctgttaagagctttgagattgacaaaggaatttac
cagacctctaatttcagggttgttccctcaggagatgttgtgagattccctaatattaca
aacttgtgtccttttggagaggtttttaatgctactaaattcccttctgtctatgcatgg
gagagaaaaaaaatttctaattgtgttgctgattactctgtgctctacaactcaacattt
ttttcaacctttaagtgctatggcgtttctgccactaagttgaatgatctttgcttctcc
aatgtctatgcagattcttttgtagtcaagggagatgatgtaagacaaatagcgccagga
caaactggtgttattgctgattataattataaattgccagatgatttcatgggttgtgtc
cttgcttggaatactaggaacattgatgctacttcaactggtaattataattataaatat
aggtatcttagacatggcaagcttaggccctttgagagagacatatctaatgtgcctttc
tcccctgatggcaaaccttgcaccccacctgctcttaattgttattggccattaaatgat
tatggtttttacaccactactggcattggctaccaaccttacagagttgtagtactttct
tttgaacttttaaatgcaccggccacggtttgtggaccaaaattatccactgaccttatt
aagaaccagtgtgtcaattttaattttaatggactcactggtactggtgtgttaactcct
tcttcaaagagatttcaaccatttcaacaatttggccgtgatgtttctgatttcactgat
tccgttcgagatcctaaaacatctgaaatattagacatttcaccttgcgcttttgggggt
gtaagtgtaattacacctggaacaaatgcttcatctgaagttgctgttctatatcaagat
gttaactgcactgatgtttctacagcaattcatgcagatcaactcacaccagcttggcgc
atatattctactggaaacaatgtattccagactcaagcaggctgtcttataggagctgag
catgtcgacacttcttatgagtgcgacattcctattggagctggcatttgtgctagttac
catacagtttctttattacgtagtactagccaaaaatctattgtggcttatactatgtct
ttaggtgctgatagttcaattgcttactctaataacaccattgctatacctactaacttt
tcaattagcattactacagaagtaatgcctgtttctatggctaaaacctccgtagattgt
aatatgtacatctgcggagattctactgaatgtgctaatttgcttctccaatatggtagc
ttttgcacacaactaaatcgtgcactctcaggtattgctgctgaacaggatcgcaacaca
cgtgaagtgttcgctcaagtcaaacaaatgtacaaaaccccaactttgaaatattttggt
ggttttaatttttcacaaatattacctgaccctctaaagccaactaagaggtcttttatt
gaggacttgctctttaataaggtgacactcgctgatgctggcttcatgaagcaatatggc
gaatgcctaggtgatattaatgctagagatctcatttgtgcgcagaagttcaatggactt
acagtgttgccacctctgctcactgatgatatgattgctgcctacactgctgctctagtt
agtggtactgccactgctggatggacatttggtgctggcgctgctcttcaaatacctttt
gctatgcaaatggcatataggttcaatggcattggagttacccaaaatgttctctatgag
aaccaaaaacaaatcgccaaccaatttaacaaggcgattagtcaaattcaagaatcactt
acaacaacatcaactgcattgggcaagctgcaagacgttgttaaccagaatgctcaagca
ttaaacacacttgttaaacaacttagctctaattttggtgcaatttcaagtgtgctaaat
gatatcctttcgcgacttgataaagtcgaggcggaggtacaaattgacaggttaattaca
ggcagacttcaaagccttcaaacctatgtaacacaacaactaatcagggctgctgaaatc
agggcttctgctaatcttgctgctactaaaatgtctgagtgtgttcttggacaatcaaaa
agagttgacttttgtggaaagggctaccaccttatgtccttcccacaagcagccccgcat
ggtgttgtcttcctacatgtcacgtatgtgccatcccaggagaggaacttcaccacagcg
ccagcaatttgtcatgaaggcaaagcatacttccctcgtgaaggtgtttttgtgtttaat
ggcacttcttggtttattacacagaggaacttcttttctccacaaataattactacagac
aatacatttgtctcaggaaattgtgatgtcgttattggcatcattaacaacacagtttat
gatcctctgcaacctgagcttgactcattcaaagaagagctggacaagtacttcaaaaat
catacatcaccagatgttgatcttggcgacatttcaggcattaacgcttctgtcgtcaac
attcaaaaagaaattgaccgcctcaatgaggtcgctaaaaatttaaatgaatcactcatt
gaccttcaagaattgggaaaatatgagcaatatattaaatggccttggtatgtttggctc
ggcttcattgctggactaattgccatcgtcatggttacaatcttgctttgttgcatgact
agttgttgcagttgcctcaagggtgcatgctcttgtggttcttgctgcaagtttgatgag
gatgactctgagccagttctcaagggtgtcaaattacattacacataa

DBGET integrated database retrieval system