KEGG   Viruses: 15042021
Entry
15042021          CDS       T40000                                 
Symbol
K202_gp3
Name
(RefSeq) Long-fingered bat hepatitis B virus; X protein
  KO
K21854  Orthohepadnavirus protein X
Virus
2050037  Long-fingered bat hepatitis B virus
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 15042021
NCBI-ProteinID: YP_007678001
RS: NC_020881
UniProt: M4Q3B7
LinkDB
Position
NC_020881:1378..1812
AA seq 144 aa
MAARLRCQLDASGNVVLLRPLCIESGGRPVARSARHSRRAAASPVPTVHGPHVTLRRLPI
CAASPAGPCALRFTCANFSGCMETTMNFVTWLGTRRRTGAKLNSGHWDMYFRESLMKEWE
EKGNDQRLYTYVSGGCRHKLLCTL
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctgctcggctgcgttgccaactggatgcttcggggaacgtcgttctgcttcgtccc
ctctgcattgaatccggcggacgccccgtcgcgaggtctgctcggcattcccgtcgcgcc
gccgcctctcccgttccgaccgtccacgggccgcacgtcactcttcgccgtctccccatc
tgtgccgcctcacctgccggaccgtgtgcacttcgcttcacctgtgccaacttctcggga
tgcatggagaccaccatgaactttgtaacctggctgggcaccagaagaaggacgggagcc
aaactgaactctggacattgggacatgtactttagggaatcattaatgaaagaatgggag
gagaagggtaatgatcaacgattgtatacatatgtatctggaggctgtaggcataaattg
ctgtgtactctgtaa

DBGET integrated database retrieval system