KEGG   Viruses: 37617585
Entry
37617585          CDS       T40000                                 
Symbol
D1R25_gp3
Name
(RefSeq) Pomona bat hepatitis B virus; X protein
  KO
K21854  Orthohepadnavirus protein X
Virus
2049933  Pomona bat hepatitis B virus
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 37617585
NCBI-ProteinID: YP_009506648
RS: NC_038503
LinkDB
Position
NC_038503:1384..1812
AA seq 142 aa
MAARLYCELDPSRDVLLLRPFGAQPGGRPVSRFPGDSNGSTASTVPPVHRQDFALRRLPA
CAYSNAGPCVLRFTCAEAAVNMETTMTNFVTWHTARQRGTVTQTLNSWQWYFGQLLMNQW
EETGWDDRIIAYVLGGCRHKLR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggctgctcggctgtactgcgaactggatccttcgagagacgtccttctgctacgtccc
ttcggagctcaacccggcggacgccccgtctcgcggtttcctggggattcgaacggctcc
accgcctctacggttccgcccgtccaccggcaggacttcgctcttcgtcgtctccccgcc
tgcgcctactcgaatgccggaccgtgtgtccttcgtttcacctgtgcagaagcggctgtc
aacatggagaccaccatgacgaactttgtaacttggcatactgcccggcaacgtggcacc
gtaacacaaactttaaactcttggcaatggtactttgggcaattattaatgaatcaatgg
gaggagacaggctgggatgatagaattattgcatatgtattaggaggctgtaggcataaa
ttgcggtga

DBGET integrated database retrieval system