KEGG   Viruses: 40526804
Entry
40526804          CDS       T40000                                 
Symbol
FLA63_gp5
Name
(RefSeq) Capuchin monkey hepatitis B virus; X protein
  KO
K21854  Orthohepadnavirus protein X
Virus
2163996  Capuchin monkey hepatitis B virus
SSDB
Motif
Pfam: X Viral_coat
Other DBs
NCBI-GeneID: 40526804
NCBI-ProteinID: YP_009666527
RS: NC_043528
LinkDB
Position
NC_043528:1388..1849
AA seq 153 aa
MAARLCCQLDPARDVLCLRPVTAEPCGRPFSGSARTSAPAAAAALPSIDGAYLSLRGLPS
CAFSSSGPCALRFTSARRMATPMNSRDLVQQLYNRTLGLAPLSTGQWERHFKDLLFEEWE
ELGVEFRLKVFVLGGCRHKLVCSVQPCIFFTSA
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctgctaggctgtgctgccaactggatcctgcgcgggacgtgctttgtctacgtccc
gtcacagcagaaccctgcggacgacccttctcggggtcggctcggacttctgcgcccgct
gccgcggctgcacttccttccatcgacggggcgtacctctctttacgcggactcccctcc
tgtgccttttcatcgtccggcccgtgtgcacttcgcttcacctctgcacgacgcatggcg
acccccatgaactcacgggacctcgtccaacagttatataaccggactcttggactcgcg
cctctgtcaactggccagtgggaacgccacttcaaagacttactgtttgaggagtgggag
gagttaggggttgagttcaggttaaaggtctttgtactaggaggctgtaggcataaattg
gtgtgctctgtacaaccatgcatctttttcacctctgcctaa

DBGET integrated database retrieval system