KEGG   Viruses: 41701928
Entry
41701928          CDS       T40000                                 
Symbol
EXK74_gp3
Name
(RefSeq) Domestic cat hepadnavirus; X protein
  KO
K21854  Orthohepadnavirus protein X
Virus
2107574  Domestic cat hepadnavirus
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 41701928
NCBI-ProteinID: YP_009553238
RS: NC_040719
LinkDB
Position
NC_040719:1226..1663
AA seq 145 aa
MAARLRCELDPWGRVLRLRPFHSESGGRAVSRTARLPDLSTSVAVSATLRARESLRGIPA
CLTSPEGPCVLRFTCADSRRCMEAAMTGLVPALLARQLGFGTWQPDLWTLRLRDLLLVEW
EEEGLTPRLCTYLVTGCAHKTLHTR
NT seq 438 nt   +upstreamnt  +downstreamnt
atggctgctcgcctgcgctgcgaattggatccttggggacgtgtccttcgtctacgtccc
ttccactctgaatccggcggacgcgccgtctcgcggactgctcggcttccggacctttcc
acctccgttgccgtttcggccacactacgggcgcgtgagtctctacgcggaatccccgcc
tgtctcacctcgcctgaaggcccgtgtgtccttcgcttcacctgtgcggactcgcgccga
tgcatggaggccgccatgactggactcgtgcccgctctgctggcgcggcagctgggtttt
gggacttggcagcccgatttgtggactttgcgcctacgtgatctgctattggtggaatgg
gaggaggagggtctgacgcccaggttatgtacatatcttgtaacaggctgcgcacataaa
accttgcacacccgctga

DBGET integrated database retrieval system