KEGG   Viruses: 43740568
Entry
43740568          CDS       T40000                                 

Gene name
S, GU280_gp02
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; surface glycoprotein
  KO
K24152  SARS coronavirus spike glycoprotein
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: CoV_S2 bCoV_S1_N bCoV_S1_RBD CoV_S1_C CoV_S2_C Baculo_PEP_C DUF2959 MukF_M CALM_bind DUF3418 TRPM_tetra GP41
Other DBs
NCBI-GeneID: 43740568
NCBI-ProteinID: YP_009724390
RS: NC_045512
UniProt: P0DTC2
LinkDB
Position
NC_045512:21563..25384
AA seq 1273 aa
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN
FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY
ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE
VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA
SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA
ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP
LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD
SEPVLKGVKLHYT
NT seq 3822 nt   +upstreamnt  +downstreamnt
atgtttgtttttcttgttttattgccactagtctctagtcagtgtgttaatcttacaacc
agaactcaattaccccctgcatacactaattctttcacacgtggtgtttattaccctgac
aaagttttcagatcctcagttttacattcaactcaggacttgttcttacctttcttttcc
aatgttacttggttccatgctatacatgtctctgggaccaatggtactaagaggtttgat
aaccctgtcctaccatttaatgatggtgtttattttgcttccactgagaagtctaacata
ataagaggctggatttttggtactactttagattcgaagacccagtccctacttattgtt
aataacgctactaatgttgttattaaagtctgtgaatttcaattttgtaatgatccattt
ttgggtgtttattaccacaaaaacaacaaaagttggatggaaagtgagttcagagtttat
tctagtgcgaataattgcacttttgaatatgtctctcagccttttcttatggaccttgaa
ggaaaacagggtaatttcaaaaatcttagggaatttgtgtttaagaatattgatggttat
tttaaaatatattctaagcacacgcctattaatttagtgcgtgatctccctcagggtttt
tcggctttagaaccattggtagatttgccaataggtattaacatcactaggtttcaaact
ttacttgctttacatagaagttatttgactcctggtgattcttcttcaggttggacagct
ggtgctgcagcttattatgtgggttatcttcaacctaggacttttctattaaaatataat
gaaaatggaaccattacagatgctgtagactgtgcacttgaccctctctcagaaacaaag
tgtacgttgaaatccttcactgtagaaaaaggaatctatcaaacttctaactttagagtc
caaccaacagaatctattgttagatttcctaatattacaaacttgtgcccttttggtgaa
gtttttaacgccaccagatttgcatctgtttatgcttggaacaggaagagaatcagcaac
tgtgttgctgattattctgtcctatataattccgcatcattttccacttttaagtgttat
ggagtgtctcctactaaattaaatgatctctgctttactaatgtctatgcagattcattt
gtaattagaggtgatgaagtcagacaaatcgctccagggcaaactggaaagattgctgat
tataattataaattaccagatgattttacaggctgcgttatagcttggaattctaacaat
cttgattctaaggttggtggtaattataattacctgtatagattgtttaggaagtctaat
ctcaaaccttttgagagagatatttcaactgaaatctatcaggccggtagcacaccttgt
aatggtgttgaaggttttaattgttactttcctttacaatcatatggtttccaacccact
aatggtgttggttaccaaccatacagagtagtagtactttcttttgaacttctacatgca
ccagcaactgtttgtggacctaaaaagtctactaatttggttaaaaacaaatgtgtcaat
ttcaacttcaatggtttaacaggcacaggtgttcttactgagtctaacaaaaagtttctg
cctttccaacaatttggcagagacattgctgacactactgatgctgtccgtgatccacag
acacttgagattcttgacattacaccatgttcttttggtggtgtcagtgttataacacca
ggaacaaatacttctaaccaggttgctgttctttatcaggatgttaactgcacagaagtc
cctgttgctattcatgcagatcaacttactcctacttggcgtgtttattctacaggttct
aatgtttttcaaacacgtgcaggctgtttaataggggctgaacatgtcaacaactcatat
gagtgtgacatacccattggtgcaggtatatgcgctagttatcagactcagactaattct
cctcggcgggcacgtagtgtagctagtcaatccatcattgcctacactatgtcacttggt
gcagaaaattcagttgcttactctaataactctattgccatacccacaaattttactatt
agtgttaccacagaaattctaccagtgtctatgaccaagacatcagtagattgtacaatg
tacatttgtggtgattcaactgaatgcagcaatcttttgttgcaatatggcagtttttgt
acacaattaaaccgtgctttaactggaatagctgttgaacaagacaaaaacacccaagaa
gtttttgcacaagtcaaacaaatttacaaaacaccaccaattaaagattttggtggtttt
aatttttcacaaatattaccagatccatcaaaaccaagcaagaggtcatttattgaagat
ctacttttcaacaaagtgacacttgcagatgctggcttcatcaaacaatatggtgattgc
cttggtgatattgctgctagagacctcatttgtgcacaaaagtttaacggccttactgtt
ttgccacctttgctcacagatgaaatgattgctcaatacacttctgcactgttagcgggt
acaatcacttctggttggacctttggtgcaggtgctgcattacaaataccatttgctatg
caaatggcttataggtttaatggtattggagttacacagaatgttctctatgagaaccaa
aaattgattgccaaccaatttaatagtgctattggcaaaattcaagactcactttcttcc
acagcaagtgcacttggaaaacttcaagatgtggtcaaccaaaatgcacaagctttaaac
acgcttgttaaacaacttagctccaattttggtgcaatttcaagtgttttaaatgatatc
ctttcacgtcttgacaaagttgaggctgaagtgcaaattgataggttgatcacaggcaga
cttcaaagtttgcagacatatgtgactcaacaattaattagagctgcagaaatcagagct
tctgctaatcttgctgctactaaaatgtcagagtgtgtacttggacaatcaaaaagagtt
gatttttgtggaaagggctatcatcttatgtccttccctcagtcagcacctcatggtgta
gtcttcttgcatgtgacttatgtccctgcacaagaaaagaacttcacaactgctcctgcc
atttgtcatgatggaaaagcacactttcctcgtgaaggtgtctttgtttcaaatggcaca
cactggtttgtaacacaaaggaatttttatgaaccacaaatcattactacagacaacaca
tttgtgtctggtaactgtgatgttgtaataggaattgtcaacaacacagtttatgatcct
ttgcaacctgaattagactcattcaaggaggagttagataaatattttaagaatcataca
tcaccagatgttgatttaggtgacatctctggcattaatgcttcagttgtaaacattcaa
aaagaaattgaccgcctcaatgaggttgccaagaatttaaatgaatctctcatcgatctc
caagaacttggaaagtatgagcagtatataaaatggccatggtacatttggctaggtttt
atagctggcttgattgccatagtaatggtgacaattatgctttgctgtatgaccagttgc
tgtagttgtctcaagggctgttgttcttgtggatcctgctgcaaatttgatgaagacgac
tctgagccagtgctcaaaggagtcaaattacattacacataa

DBGET integrated database retrieval system