KEGG   Viruses: 43740578
Entry
43740578          CDS       T40000                                 

Gene name
ORF1ab, GU280_gp01
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; ORF1ab polyprotein
  KO
K24149  SARS coronavirus replicase polyprotein 1ab
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: CoV_Methyltr_1 CoV_RPol_N CoV_Methyltr_2 CoV_NSP3_C Peptidase_C30 CoV_peptidase CoV_NSP4_N CoV_NSP8 RdRP_1 bCoV_SUD_M CoV_NSP15_C CoV_NSP6 CoV_NSP10 bCoV_NSP3_N CoV_NSP2_N CoV_NSP9 CoV_NSP4_C bCoV_NAR CoV_NSP7 bCoV_SUD_C bCoV_NSP1 CoV_NSP15_N CoV_NSP15_M CoV_NSP2_C Macro AAA_11 AAA_12 AAA_30 Viral_helicase1 UvrD_C_2 AAA_19
Other DBs
NCBI-GeneID: 43740578
NCBI-ProteinID: YP_009724389
RS: NC_045512
UniProt: P0DTD1
LinkDB
Position
NC_045512:join(266..13468,13468..21555)
AA seq 7096 aa
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN
NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ
HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN
GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA
HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND
LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL
SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV
LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL
LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN
LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK
GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY
PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK
KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA
CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC
LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS
PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT
YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV
LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA
GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH
FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV
GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG
FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL
KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI
ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD
FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE
GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV
SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL
CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND
FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK
TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV
SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR
WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN
GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV
MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK
VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM
LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL
NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA
QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY
KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV
PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES
FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG
CSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKF
LKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDG
DMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVEN
PDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPG
SGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFK
YWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
RELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQ
LLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALF
AYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVV
IGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSL
SHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALL
STDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNS
TYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVY
LPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYI
RKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRC
GACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHK
PPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAE
TLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIG
EYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTL
NISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDA
LCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEI
SMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDM
FLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVV
REFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSC
NVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVI
TGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFIT
REEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSR
VSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSM
KYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQS
NHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHM
VVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSD
KFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSA
FVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYL
DAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIIN
NTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY
KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSV
KGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQ
MEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDF
IPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEIS
FMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMM
NVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND
FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLA
LGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGY
VMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLII
RENNRVVISSDVLVNN
NT seq 21291 nt   +upstreamnt  +downstreamnt
atggagagccttgtccctggtttcaacgagaaaacacacgtccaactcagtttgcctgtt
ttacaggttcgcgacgtgctcgtacgtggctttggagactccgtggaggaggtcttatca
gaggcacgtcaacatcttaaagatggcacttgtggcttagtagaagttgaaaaaggcgtt
ttgcctcaacttgaacagccctatgtgttcatcaaacgttcggatgctcgaactgcacct
catggtcatgttatggttgagctggtagcagaactcgaaggcattcagtacggtcgtagt
ggtgagacacttggtgtccttgtccctcatgtgggcgaaataccagtggcttaccgcaag
gttcttcttcgtaagaacggtaataaaggagctggtggccatagttacggcgccgatcta
aagtcatttgacttaggcgacgagcttggcactgatccttatgaagattttcaagaaaac
tggaacactaaacatagcagtggtgttacccgtgaactcatgcgtgagcttaacggaggg
gcatacactcgctatgtcgataacaacttctgtggccctgatggctaccctcttgagtgc
attaaagaccttctagcacgtgctggtaaagcttcatgcactttgtccgaacaactggac
tttattgacactaagaggggtgtatactgctgccgtgaacatgagcatgaaattgcttgg
tacacggaacgttctgaaaagagctatgaattgcagacaccttttgaaattaaattggca
aagaaatttgacaccttcaatggggaatgtccaaattttgtatttcccttaaattccata
atcaagactattcaaccaagggttgaaaagaaaaagcttgatggctttatgggtagaatt
cgatctgtctatccagttgcgtcaccaaatgaatgcaaccaaatgtgcctttcaactctc
atgaagtgtgatcattgtggtgaaacttcatggcagacgggcgattttgttaaagccact
tgcgaattttgtggcactgagaatttgactaaagaaggtgccactacttgtggttactta
ccccaaaatgctgttgttaaaatttattgtccagcatgtcacaattcagaagtaggacct
gagcatagtcttgccgaataccataatgaatctggcttgaaaaccattcttcgtaagggt
ggtcgcactattgcctttggaggctgtgtgttctcttatgttggttgccataacaagtgt
gcctattgggttccacgtgctagcgctaacataggttgtaaccatacaggtgttgttgga
gaaggttccgaaggtcttaatgacaaccttcttgaaatactccaaaaagagaaagtcaac
atcaatattgttggtgactttaaacttaatgaagagatcgccattattttggcatctttt
tctgcttccacaagtgcttttgtggaaactgtgaaaggtttggattataaagcattcaaa
caaattgttgaatcctgtggtaattttaaagttacaaaaggaaaagctaaaaaaggtgcc
tggaatattggtgaacagaaatcaatactgagtcctctttatgcatttgcatcagaggct
gctcgtgttgtacgatcaattttctcccgcactcttgaaactgctcaaaattctgtgcgt
gttttacagaaggccgctataacaatactagatggaatttcacagtattcactgagactc
attgatgctatgatgttcacatctgatttggctactaacaatctagttgtaatggcctac
attacaggtggtgttgttcagttgacttcgcagtggctaactaacatctttggcactgtt
tatgaaaaactcaaacccgtccttgattggcttgaagagaagtttaaggaaggtgtagag
tttcttagagacggttgggaaattgttaaatttatctcaacctgtgcttgtgaaattgtc
ggtggacaaattgtcacctgtgcaaaggaaattaaggagagtgttcagacattctttaag
cttgtaaataaatttttggctttgtgtgctgactctatcattattggtggagctaaactt
aaagccttgaatttaggtgaaacatttgtcacgcactcaaagggattgtacagaaagtgt
gttaaatccagagaagaaactggcctactcatgcctctaaaagccccaaaagaaattatc
ttcttagagggagaaacacttcccacagaagtgttaacagaggaagttgtcttgaaaact
ggtgatttacaaccattagaacaacctactagtgaagctgttgaagctccattggttggt
acaccagtttgtattaacgggcttatgttgctcgaaatcaaagacacagaaaagtactgt
gcccttgcacctaatatgatggtaacaaacaataccttcacactcaaaggcggtgcacca
acaaaggttacttttggtgatgacactgtgatagaagtgcaaggttacaagagtgtgaat
atcacttttgaacttgatgaaaggattgataaagtacttaatgagaagtgctctgcctat
acagttgaactcggtacagaagtaaatgagttcgcctgtgttgtggcagatgctgtcata
aaaactttgcaaccagtatctgaattacttacaccactgggcattgatttagatgagtgg
agtatggctacatactacttatttgatgagtctggtgagtttaaattggcttcacatatg
tattgttctttctaccctccagatgaggatgaagaagaaggtgattgtgaagaagaagag
tttgagccatcaactcaatatgagtatggtactgaagatgattaccaaggtaaacctttg
gaatttggtgccacttctgctgctcttcaacctgaagaagagcaagaagaagattggtta
gatgatgatagtcaacaaactgttggtcaacaagacggcagtgaggacaatcagacaact
actattcaaacaattgttgaggttcaacctcaattagagatggaacttacaccagttgtt
cagactattgaagtgaatagttttagtggttatttaaaacttactgacaatgtatacatt
aaaaatgcagacattgtggaagaagctaaaaaggtaaaaccaacagtggttgttaatgca
gccaatgtttaccttaaacatggaggaggtgttgcaggagccttaaataaggctactaac
aatgccatgcaagttgaatctgatgattacatagctactaatggaccacttaaagtgggt
ggtagttgtgttttaagcggacacaatcttgctaaacactgtcttcatgttgtcggccca
aatgttaacaaaggtgaagacattcaacttcttaagagtgcttatgaaaattttaatcag
cacgaagttctacttgcaccattattatcagctggtatttttggtgctgaccctatacat
tctttaagagtttgtgtagatactgttcgcacaaatgtctacttagctgtctttgataaa
aatctctatgacaaacttgtttcaagctttttggaaatgaagagtgaaaagcaagttgaa
caaaagatcgctgagattcctaaagaggaagttaagccatttataactgaaagtaaacct
tcagttgaacagagaaaacaagatgataagaaaatcaaagcttgtgttgaagaagttaca
acaactctggaagaaactaagttcctcacagaaaacttgttactttatattgacattaat
ggcaatcttcatccagattctgccactcttgttagtgacattgacatcactttcttaaag
aaagatgctccatatatagtgggtgatgttgttcaagagggtgttttaactgctgtggtt
atacctactaaaaaggctggtggcactactgaaatgctagcgaaagctttgagaaaagtg
ccaacagacaattatataaccacttacccgggtcagggtttaaatggttacactgtagag
gaggcaaagacagtgcttaaaaagtgtaaaagtgccttttacattctaccatctattatc
tctaatgagaagcaagaaattcttggaactgtttcttggaatttgcgagaaatgcttgca
catgcagaagaaacacgcaaattaatgcctgtctgtgtggaaactaaagccatagtttca
actatacagcgtaaatataagggtattaaaatacaagagggtgtggttgattatggtgct
agattttacttttacaccagtaaaacaactgtagcgtcacttatcaacacacttaacgat
ctaaatgaaactcttgttacaatgccacttggctatgtaacacatggcttaaatttggaa
gaagctgctcggtatatgagatctctcaaagtgccagctacagtttctgtttcttcacct
gatgctgttacagcgtataatggttatcttacttcttcttctaaaacacctgaagaacat
tttattgaaaccatctcacttgctggttcctataaagattggtcctattctggacaatct
acacaactaggtatagaatttcttaagagaggtgataaaagtgtatattacactagtaat
cctaccacattccacctagatggtgaagttatcacctttgacaatcttaagacacttctt
tctttgagagaagtgaggactattaaggtgtttacaacagtagacaacattaacctccac
acgcaagttgtggacatgtcaatgacatatggacaacagtttggtccaacttatttggat
ggagctgatgttactaaaataaaacctcataattcacatgaaggtaaaacattttatgtt
ttacctaatgatgacactctacgtgttgaggcttttgagtactaccacacaactgatcct
agttttctgggtaggtacatgtcagcattaaatcacactaaaaagtggaaatacccacaa
gttaatggtttaacttctattaaatgggcagataacaactgttatcttgccactgcattg
ttaacactccaacaaatagagttgaagtttaatccacctgctctacaagatgcttattac
agagcaagggctggtgaagctgctaacttttgtgcacttatcttagcctactgtaataag
acagtaggtgagttaggtgatgttagagaaacaatgagttacttgtttcaacatgccaat
ttagattcttgcaaaagagtcttgaacgtggtgtgtaaaacttgtggacaacagcagaca
acccttaagggtgtagaagctgttatgtacatgggcacactttcttatgaacaatttaag
aaaggtgttcagataccttgtacgtgtggtaaacaagctacaaaatatctagtacaacag
gagtcaccttttgttatgatgtcagcaccacctgctcagtatgaacttaagcatggtaca
tttacttgtgctagtgagtacactggtaattaccagtgtggtcactataaacatataact
tctaaagaaactttgtattgcatagacggtgctttacttacaaagtcctcagaatacaaa
ggtcctattacggatgttttctacaaagaaaacagttacacaacaaccataaaaccagtt
acttataaattggatggtgttgtttgtacagaaattgaccctaagttggacaattattat
aagaaagacaattcttatttcacagagcaaccaattgatcttgtaccaaaccaaccatat
ccaaacgcaagcttcgataattttaagtttgtatgtgataatatcaaatttgctgatgat
ttaaaccagttaactggttataagaaacctgcttcaagagagcttaaagttacatttttc
cctgacttaaatggtgatgtggtggctattgattataaacactacacaccctcttttaag
aaaggagctaaattgttacataaacctattgtttggcatgttaacaatgcaactaataaa
gccacgtataaaccaaatacctggtgtatacgttgtctttggagcacaaaaccagttgaa
acatcaaattcgtttgatgtactgaagtcagaggacgcgcagggaatggataatcttgcc
tgcgaagatctaaaaccagtctctgaagaagtagtggaaaatcctaccatacagaaagac
gttcttgagtgtaatgtgaaaactaccgaagttgtaggagacattatacttaaaccagca
aataatagtttaaaaattacagaagaggttggccacacagatctaatggctgcttatgta
gacaattctagtcttactattaagaaacctaatgaattatctagagtattaggtttgaaa
acccttgctactcatggtttagctgctgttaatagtgtcccttgggatactatagctaat
tatgctaagccttttcttaacaaagttgttagtacaactactaacatagttacacggtgt
ttaaaccgtgtttgtactaattatatgccttatttctttactttattgctacaattgtgt
acttttactagaagtacaaattctagaattaaagcatctatgccgactactatagcaaag
aatactgttaagagtgtcggtaaattttgtctagaggcttcatttaattatttgaagtca
cctaatttttctaaactgataaatattataatttggtttttactattaagtgtttgccta
ggttctttaatctactcaaccgctgctttaggtgttttaatgtctaatttaggcatgcct
tcttactgtactggttacagagaaggctatttgaactctactaatgtcactattgcaacc
tactgtactggttctataccttgtagtgtttgtcttagtggtttagattctttagacacc
tatccttctttagaaactatacaaattaccatttcatcttttaaatgggatttaactgct
tttggcttagttgcagagtggtttttggcatatattcttttcactaggtttttctatgta
cttggattggctgcaatcatgcaattgtttttcagctattttgcagtacattttattagt
aattcttggcttatgtggttaataattaatcttgtacaaatggccccgatttcagctatg
gttagaatgtacatcttctttgcatcattttattatgtatggaaaagttatgtgcatgtt
gtagacggttgtaattcatcaacttgtatgatgtgttacaaacgtaatagagcaacaaga
gtcgaatgtacaactattgttaatggtgttagaaggtccttttatgtctatgctaatgga
ggtaaaggcttttgcaaactacacaattggaattgtgttaattgtgatacattctgtgct
ggtagtacatttattagtgatgaagttgcgagagacttgtcactacagtttaaaagacca
ataaatcctactgaccagtcttcttacatcgttgatagtgttacagtgaagaatggttcc
atccatctttactttgataaagctggtcaaaagacttatgaaagacattctctctctcat
tttgttaacttagacaacctgagagctaataacactaaaggttcattgcctattaatgtt
atagtttttgatggtaaatcaaaatgtgaagaatcatctgcaaaatcagcgtctgtttac
tacagtcagcttatgtgtcaacctatactgttactagatcaggcattagtgtctgatgtt
ggtgatagtgcggaagttgcagttaaaatgtttgatgcttacgttaatacgttttcatca
acttttaacgtaccaatggaaaaactcaaaacactagttgcaactgcagaagctgaactt
gcaaagaatgtgtccttagacaatgtcttatctacttttatttcagcagctcggcaaggg
tttgttgattcagatgtagaaactaaagatgttgttgaatgtcttaaattgtcacatcaa
tctgacatagaagttactggcgatagttgtaataactatatgctcacctataacaaagtt
gaaaacatgacaccccgtgaccttggtgcttgtattgactgtagtgcgcgtcatattaat
gcgcaggtagcaaaaagtcacaacattgctttgatatggaacgttaaagatttcatgtca
ttgtctgaacaactacgaaaacaaatacgtagtgctgctaaaaagaataacttacctttt
aagttgacatgtgcaactactagacaagttgttaatgttgtaacaacaaagatagcactt
aagggtggtaaaattgttaataattggttgaagcagttaattaaagttacacttgtgttc
ctttttgttgctgctattttctatttaataacacctgttcatgtcatgtctaaacatact
gacttttcaagtgaaatcataggatacaaggctattgatggtggtgtcactcgtgacata
gcatctacagatacttgttttgctaacaaacatgctgattttgacacatggtttagccag
cgtggtggtagttatactaatgacaaagcttgcccattgattgctgcagtcataacaaga
gaagtgggttttgtcgtgcctggtttgcctggcacgatattacgcacaactaatggtgac
tttttgcatttcttacctagagtttttagtgcagttggtaacatctgttacacaccatca
aaacttatagagtacactgactttgcaacatcagcttgtgttttggctgctgaatgtaca
atttttaaagatgcttctggtaagccagtaccatattgttatgataccaatgtactagaa
ggttctgttgcttatgaaagtttacgccctgacacacgttatgtgctcatggatggctct
attattcaatttcctaacacctaccttgaaggttctgttagagtggtaacaacttttgat
tctgagtactgtaggcacggcacttgtgaaagatcagaagctggtgtttgtgtatctact
agtggtagatgggtacttaacaatgattattacagatctttaccaggagttttctgtggt
gtagatgctgtaaatttacttactaatatgtttacaccactaattcaacctattggtgct
ttggacatatcagcatctatagtagctggtggtattgtagctatcgtagtaacatgcctt
gcctactattttatgaggtttagaagagcttttggtgaatacagtcatgtagttgccttt
aatactttactattccttatgtcattcactgtactctgtttaacaccagtttactcattc
ttacctggtgtttattctgttatttacttgtacttgacattttatcttactaatgatgtt
tcttttttagcacatattcagtggatggttatgttcacacctttagtacctttctggata
acaattgcttatatcatttgtatttccacaaagcatttctattggttctttagtaattac
ctaaagagacgtgtagtctttaatggtgtttcctttagtacttttgaagaagctgcgctg
tgcacctttttgttaaataaagaaatgtatctaaagttgcgtagtgatgtgctattacct
cttacgcaatataatagatacttagctctttataataagtacaagtattttagtggagca
atggatacaactagctacagagaagctgcttgttgtcatctcgcaaaggctctcaatgac
ttcagtaactcaggttctgatgttctttaccaaccaccacaaacctctatcacctcagct
gttttgcagagtggttttagaaaaatggcattcccatctggtaaagttgagggttgtatg
gtacaagtaacttgtggtacaactacacttaacggtctttggcttgatgacgtagtttac
tgtccaagacatgtgatctgcacctctgaagacatgcttaaccctaattatgaagattta
ctcattcgtaagtctaatcataatttcttggtacaggctggtaatgttcaactcagggtt
attggacattctatgcaaaattgtgtacttaagcttaaggttgatacagccaatcctaag
acacctaagtataagtttgttcgcattcaaccaggacagactttttcagtgttagcttgt
tacaatggttcaccatctggtgtttaccaatgtgctatgaggcccaatttcactattaag
ggttcattccttaatggttcatgtggtagtgttggttttaacatagattatgactgtgtc
tctttttgttacatgcaccatatggaattaccaactggagttcatgctggcacagactta
gaaggtaacttttatggaccttttgttgacaggcaaacagcacaagcagctggtacggac
acaactattacagttaatgttttagcttggttgtacgctgctgttataaatggagacagg
tggtttctcaatcgatttaccacaactcttaatgactttaaccttgtggctatgaagtac
aattatgaacctctaacacaagaccatgttgacatactaggacctctttctgctcaaact
ggaattgccgttttagatatgtgtgcttcattaaaagaattactgcaaaatggtatgaat
ggacgtaccatattgggtagtgctttattagaagatgaatttacaccttttgatgttgtt
agacaatgctcaggtgttactttccaaagtgcagtgaaaagaacaatcaagggtacacac
cactggttgttactcacaattttgacttcacttttagttttagtccagagtactcaatgg
tctttgttcttttttttgtatgaaaatgcctttttaccttttgctatgggtattattgct
atgtctgcttttgcaatgatgtttgtcaaacataagcatgcatttctctgtttgtttttg
ttaccttctcttgccactgtagcttattttaatatggtctatatgcctgctagttgggtg
atgcgtattatgacatggttggatatggttgatactagtttgtctggttttaagctaaaa
gactgtgttatgtatgcatcagctgtagtgttactaatccttatgacagcaagaactgtg
tatgatgatggtgctaggagagtgtggacacttatgaatgtcttgacactcgtttataaa
gtttattatggtaatgctttagatcaagccatttccatgtgggctcttataatctctgtt
acttctaactactcaggtgtagttacaactgtcatgtttttggccagaggtattgttttt
atgtgtgttgagtattgccctattttcttcataactggtaatacacttcagtgtataatg
ctagtttattgtttcttaggctatttttgtacttgttactttggcctcttttgtttactc
aaccgctactttagactgactcttggtgtttatgattacttagtttctacacaggagttt
agatatatgaattcacagggactactcccacccaagaatagcatagatgccttcaaactc
aacattaaattgttgggtgttggtggcaaaccttgtatcaaagtagccactgtacagtct
aaaatgtcagatgtaaagtgcacatcagtagtcttactctcagttttgcaacaactcaga
gtagaatcatcatctaaattgtgggctcaatgtgtccagttacacaatgacattctctta
gctaaagatactactgaagcctttgaaaaaatggtttcactactttctgttttgctttcc
atgcagggtgctgtagacataaacaagctttgtgaagaaatgctggacaacagggcaacc
ttacaagctatagcctcagagtttagttcccttccatcatatgcagcttttgctactgct
caagaagcttatgagcaggctgttgctaatggtgattctgaagttgttcttaaaaagttg
aagaagtctttgaatgtggctaaatctgaatttgaccgtgatgcagccatgcaacgtaag
ttggaaaagatggctgatcaagctatgacccaaatgtataaacaggctagatctgaggac
aagagggcaaaagttactagtgctatgcagacaatgcttttcactatgcttagaaagttg
gataatgatgcactcaacaacattatcaacaatgcaagagatggttgtgttcccttgaac
ataatacctcttacaacagcagccaaactaatggttgtcataccagactataacacatat
aaaaatacgtgtgatggtacaacatttacttatgcatcagcattgtgggaaatccaacag
gttgtagatgcagatagtaaaattgttcaacttagtgaaattagtatggacaattcacct
aatttagcatggcctcttattgtaacagctttaagggccaattctgctgtcaaattacag
aataatgagcttagtcctgttgcactacgacagatgtcttgtgctgccggtactacacaa
actgcttgcactgatgacaatgcgttagcttactacaacacaacaaagggaggtaggttt
gtacttgcactgttatccgatttacaggatttgaaatgggctagattccctaagagtgat
ggaactggtactatctatacagaactggaaccaccttgtaggtttgttacagacacacct
aaaggtcctaaagtgaagtatttatactttattaaaggattaaacaacctaaatagaggt
atggtacttggtagtttagctgccacagtacgtctacaagctggtaatgcaacagaagtg
cctgccaattcaactgtattatctttctgtgcttttgctgtagatgctgctaaagcttac
aaagattatctagctagtgggggacaaccaatcactaattgtgttaagatgttgtgtaca
cacactggtactggtcaggcaataacagttacaccggaagccaatatggatcaagaatcc
tttggtggtgcatcgtgttgtctgtactgccgttgccacatagatcatccaaatcctaaa
ggattttgtgacttaaaaggtaagtatgtacaaatacctacaacttgtgctaatgaccct
gtgggttttacacttaaaaacacagtctgtaccgtctgcggtatgtggaaaggttatggc
tgtagttgtgatcaactccgcgaacccatgcttcagtcagctgatgcacaatcgttttta
aaccgggtttgcggtgtaagtgcagcccgtcttacaccgtgcggcacaggcactagtact
gatgtcgtatacagggcttttgacatctacaatgataaagtagctggttttgctaaattc
ctaaaaactaattgttgtcgcttccaagaaaaggacgaagatgacaatttaattgattct
tactttgtagttaagagacacactttctctaactaccaacatgaagaaacaatttataat
ttacttaaggattgtccagctgttgctaaacatgacttctttaagtttagaatagacggt
gacatggtaccacatatatcacgtcaacgtcttactaaatacacaatggcagacctcgtc
tatgctttaaggcattttgatgaaggtaattgtgacacattaaaagaaatacttgtcaca
tacaattgttgtgatgatgattatttcaataaaaaggactggtatgattttgtagaaaac
ccagatatattacgcgtatacgccaacttaggtgaacgtgtacgccaagctttgttaaaa
acagtacaattctgtgatgccatgcgaaatgctggtattgttggtgtactgacattagat
aatcaagatctcaatggtaactggtatgatttcggtgatttcatacaaaccacgccaggt
agtggagttcctgttgtagattcttattattcattgttaatgcctatattaaccttgacc
agggctttaactgcagagtcacatgttgacactgacttaacaaagccttacattaagtgg
gatttgttaaaatatgacttcacggaagagaggttaaaactctttgaccgttattttaaa
tattgggatcagacataccacccaaattgtgttaactgtttggatgacagatgcattctg
cattgtgcaaactttaatgttttattctctacagtgttcccacctacaagttttggacca
ctagtgagaaaaatatttgttgatggtgttccatttgtagtttcaactggataccacttc
agagagctaggtgttgtacataatcaggatgtaaacttacatagctctagacttagtttt
aaggaattacttgtgtatgctgctgaccctgctatgcacgctgcttctggtaatctatta
ctagataaacgcactacgtgcttttcagtagctgcacttactaacaatgttgcttttcaa
actgtcaaacccggtaattttaacaaagacttctatgactttgctgtgtctaagggtttc
tttaaggaaggaagttctgttgaattaaaacacttcttctttgctcaggatggtaatgct
gctatcagcgattatgactactatcgttataatctaccaacaatgtgtgatatcagacaa
ctactatttgtagttgaagttgttgataagtactttgattgttacgatggtggctgtatt
aatgctaaccaagtcatcgtcaacaacctagacaaatcagctggttttccatttaataaa
tggggtaaggctagactttattatgattcaatgagttatgaggatcaagatgcacttttc
gcatatacaaaacgtaatgtcatccctactataactcaaatgaatcttaagtatgccatt
agtgcaaagaatagagctcgcaccgtagctggtgtctctatctgtagtactatgaccaat
agacagtttcatcaaaaattattgaaatcaatagccgccactagaggagctactgtagta
attggaacaagcaaattctatggtggttggcacaacatgttaaaaactgtttatagtgat
gtagaaaaccctcaccttatgggttgggattatcctaaatgtgatagagccatgcctaac
atgcttagaattatggcctcacttgttcttgctcgcaaacatacaacgtgttgtagcttg
tcacaccgtttctatagattagctaatgagtgtgctcaagtattgagtgaaatggtcatg
tgtggcggttcactatatgttaaaccaggtggaacctcatcaggagatgccacaactgct
tatgctaatagtgtttttaacatttgtcaagctgtcacggccaatgttaatgcactttta
tctactgatggtaacaaaattgccgataagtatgtccgcaatttacaacacagactttat
gagtgtctctatagaaatagagatgttgacacagactttgtgaatgagttttacgcatat
ttgcgtaaacatttctcaatgatgatactctctgacgatgctgttgtgtgtttcaatagc
acttatgcatctcaaggtctagtggctagcataaagaactttaagtcagttctttattat
caaaacaatgtttttatgtctgaagcaaaatgttggactgagactgaccttactaaagga
cctcatgaattttgctctcaacatacaatgctagttaaacagggtgatgattatgtgtac
cttccttacccagatccatcaagaatcctaggggccggctgttttgtagatgatatcgta
aaaacagatggtacacttatgattgaacggttcgtgtctttagctatagatgcttaccca
cttactaaacatcctaatcaggagtatgctgatgtctttcatttgtacttacaatacata
agaaagctacatgatgagttaacaggacacatgttagacatgtattctgttatgcttact
aatgataacacttcaaggtattgggaacctgagttttatgaggctatgtacacaccgcat
acagtcttacaggctgttggggcttgtgttctttgcaattcacagacttcattaagatgt
ggtgcttgcatacgtagaccattcttatgttgtaaatgctgttacgaccatgtcatatca
acatcacataaattagtcttgtctgttaatccgtatgtttgcaatgctccaggttgtgat
gtcacagatgtgactcaactttacttaggaggtatgagctattattgtaaatcacataaa
ccacccattagttttccattgtgtgctaatggacaagtttttggtttatataaaaataca
tgtgttggtagcgataatgttactgactttaatgcaattgcaacatgtgactggacaaat
gctggtgattacattttagctaacacctgtactgaaagactcaagctttttgcagcagaa
acgctcaaagctactgaggagacatttaaactgtcttatggtattgctactgtacgtgaa
gtgctgtctgacagagaattacatctttcatgggaagttggtaaacctagaccaccactt
aaccgaaattatgtctttactggttatcgtgtaactaaaaacagtaaagtacaaatagga
gagtacacctttgaaaaaggtgactatggtgatgctgttgtttaccgaggtacaacaact
tacaaattaaatgttggtgattattttgtgctgacatcacatacagtaatgccattaagt
gcacctacactagtgccacaagagcactatgttagaattactggcttatacccaacactc
aatatctcagatgagttttctagcaatgttgcaaattatcaaaaggttggtatgcaaaag
tattctacactccagggaccacctggtactggtaagagtcattttgctattggcctagct
ctctactacccttctgctcgcatagtgtatacagcttgctctcatgccgctgttgatgca
ctatgtgagaaggcattaaaatatttgcctatagataaatgtagtagaattatacctgca
cgtgctcgtgtagagtgttttgataaattcaaagtgaattcaacattagaacagtatgtc
ttttgtactgtaaatgcattgcctgagacgacagcagatatagttgtctttgatgaaatt
tcaatggccacaaattatgatttgagtgttgtcaatgccagattacgtgctaagcactat
gtgtacattggcgaccctgctcaattacctgcaccacgcacattgctaactaagggcaca
ctagaaccagaatatttcaattcagtgtgtagacttatgaaaactataggtccagacatg
ttcctcggaacttgtcggcgttgtcctgctgaaattgttgacactgtgagtgctttggtt
tatgataataagcttaaagcacataaagacaaatcagctcaatgctttaaaatgttttat
aagggtgttatcacgcatgatgtttcatctgcaattaacaggccacaaataggcgtggta
agagaattccttacacgtaaccctgcttggagaaaagctgtctttatttcaccttataat
tcacagaatgctgtagcctcaaagattttgggactaccaactcaaactgttgattcatca
cagggctcagaatatgactatgtcatattcactcaaaccactgaaacagctcactcttgt
aatgtaaacagatttaatgttgctattaccagagcaaaagtaggcatactttgcataatg
tctgatagagacctttatgacaagttgcaatttacaagtcttgaaattccacgtaggaat
gtggcaactttacaagctgaaaatgtaacaggactctttaaagattgtagtaaggtaatc
actgggttacatcctacacaggcacctacacacctcagtgttgacactaaattcaaaact
gaaggtttatgtgttgacatacctggcatacctaaggacatgacctatagaagactcatc
tctatgatgggttttaaaatgaattatcaagttaatggttaccctaacatgtttatcacc
cgcgaagaagctataagacatgtacgtgcatggattggcttcgatgtcgaggggtgtcat
gctactagagaagctgttggtaccaatttacctttacagctaggtttttctacaggtgtt
aacctagttgctgtacctacaggttatgttgatacacctaataatacagatttttccaga
gttagtgctaaaccaccgcctggagatcaatttaaacacctcataccacttatgtacaaa
ggacttccttggaatgtagtgcgtataaagattgtacaaatgttaagtgacacacttaaa
aatctctctgacagagtcgtatttgtcttatgggcacatggctttgagttgacatctatg
aagtattttgtgaaaataggacctgagcgcacctgttgtctatgtgatagacgtgccaca
tgcttttccactgcttcagacacttatgcctgttggcatcattctattggatttgattac
gtctataatccgtttatgattgatgttcaacaatggggttttacaggtaacctacaaagc
aaccatgatctgtattgtcaagtccatggtaatgcacatgtagctagttgtgatgcaatc
atgactaggtgtctagctgtccacgagtgctttgttaagcgtgttgactggactattgaa
tatcctataattggtgatgaactgaagattaatgcggcttgtagaaaggttcaacacatg
gttgttaaagctgcattattagcagacaaattcccagttcttcacgacattggtaaccct
aaagctattaagtgtgtacctcaagctgatgtagaatggaagttctatgatgcacagcct
tgtagtgacaaagcttataaaatagaagaattattctattcttatgccacacattctgac
aaattcacagatggtgtatgcctattttggaattgcaatgtcgatagatatcctgctaat
tccattgtttgtagatttgacactagagtgctatctaaccttaacttgcctggttgtgat
ggtggcagtttgtatgtaaataaacatgcattccacacaccagcttttgataaaagtgct
tttgttaatttaaaacaattaccatttttctattactctgacagtccatgtgagtctcat
ggaaaacaagtagtgtcagatatagattatgtaccactaaagtctgctacgtgtataaca
cgttgcaatttaggtggtgctgtctgtagacatcatgctaatgagtacagattgtatctc
gatgcttataacatgatgatctcagctggctttagcttgtgggtttacaaacaatttgat
acttataacctctggaacacttttacaagacttcagagtttagaaaatgtggcttttaat
gttgtaaataagggacactttgatggacaacagggtgaagtaccagtttctatcattaat
aacactgtttacacaaaagttgatggtgttgatgtagaattgtttgaaaataaaacaaca
ttacctgttaatgtagcatttgagctttgggctaagcgcaacattaaaccagtaccagag
gtgaaaatactcaataatttgggtgtggacattgctgctaatactgtgatctgggactac
aaaagagatgctccagcacatatatctactattggtgtttgttctatgactgacatagcc
aagaaaccaactgaaacgatttgtgcaccactcactgtcttttttgatggtagagttgat
ggtcaagtagacttatttagaaatgcccgtaatggtgttcttattacagaaggtagtgtt
aaaggtttacaaccatctgtaggtcccaaacaagctagtcttaatggagtcacattaatt
ggagaagccgtaaaaacacagttcaattattataagaaagttgatggtgttgtccaacaa
ttacctgaaacttactttactcagagtagaaatttacaagaatttaaacccaggagtcaa
atggaaattgatttcttagaattagctatggatgaattcattgaacggtataaattagaa
ggctatgccttcgaacatatcgtttatggagattttagtcatagtcagttaggtggttta
catctactgattggactagctaaacgttttaaggaatcaccttttgaattagaagatttt
attcctatggacagtacagttaaaaactatttcataacagatgcgcaaacaggttcatct
aagtgtgtgtgttctgttattgatttattacttgatgattttgttgaaataataaaatcc
caagatttatctgtagtttctaaggttgtcaaagtgactattgactatacagaaatttca
tttatgctttggtgtaaagatggccatgtagaaacattttacccaaaattacaatctagt
caagcgtggcaaccgggtgttgctatgcctaatctttacaaaatgcaaagaatgctatta
gaaaagtgtgaccttcaaaattatggtgatagtgcaacattacctaaaggcataatgatg
aatgtcgcaaaatatactcaactgtgtcaatatttaaacacattaacattagctgtaccc
tataatatgagagttatacattttggtgctggttctgataaaggagttgcaccaggtaca
gctgttttaagacagtggttgcctacgggtacgctgcttgtcgattcagatcttaatgac
tttgtctctgatgcagattcaactttgattggtgattgtgcaactgtacatacagctaat
aaatgggatctcattattagtgatatgtacgaccctaagactaaaaatgttacaaaagaa
aatgactctaaagagggttttttcacttacatttgtgggtttatacaacaaaagctagct
cttggaggttccgtggctataaagataacagaacattcttggaatgctgatctttataag
ctcatgggacacttcgcatggtggacagcctttgttactaatgtgaatgcgtcatcatct
gaagcatttttaattggatgtaattatcttggcaaaccacgcgaacaaatagatggttat
gtcatgcatgcaaattacatattttggaggaatacaaatccaattcagttgtcttcctat
tctttatttgacatgagtaaatttccccttaaattaaggggtactgctgttatgtcttta
aaagaaggtcaaatcaatgatatgattttatctcttcttagtaaaggtagacttataatt
agagaaaacaacagagttgttatttctagtgatgttcttgttaacaactaa

DBGET integrated database retrieval system