KEGG   Viruses: 4961460
Entry
4961460           CDS       T40000                                 

Gene name
HHV8GK18_gp84
Definition
(RefSeq) Human gammaherpesvirus 8; ORF74
  KO
K21667  KSHV G-protein coupled receptor
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 4961460
NCBI-ProteinID: YP_001129433
RS: NC_009333
UniProt: Q98146 Q76SF8
LinkDB
Position
NC_009333:129520..130548
AA seq 342 aa
MAAEDFLTIFLDDDESWNETLNMSGYDYSGNFSLEVSVCEMTTVVPYTWNVGILSLIFLI
NVLGNGLVTYIFCKHRSRAGAIDILLLGICLNSLCLSISLLAEVLMFLFPNIISTGLCRL
EIFFYYLYVYLDIFSVVCVSLVRYLLVAYSTRSWPKKQSLGWVLTSAALLIALVLSGDAC
RHRSRVVDPVSKQAMCYENAGNMTADWRLHVRTVSVTAGFLLPLALLILFYALTWCVVRR
TKLQARRKVRGVIVAVVLLFFVFCFPYHVLNLLDTLLRRRWIRDSCYTRGLINVGLAVTS
LLQALYSAVVPLIYSCLGSLFRQRMYGLFQSLRQSFMSGATT
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcggccgaggatttcctaaccatcttcttagatgatgatgaatcctggaatgaaact
ctaaatatgagcggatatgactactctggaaacttcagcctagaagtgagcgtgtgtgag
atgaccaccgtggtgccttacacgtggaacgttggaatactctctctgattttcctcata
aatgttcttggaaatggattggtcacctacattttttgcaagcaccgatcgcgggcagga
gcgatagatatactgctcctgggtatctgcctaaactcgctgtgtcttagcatatctcta
ttggcagaagtgttgatgtttttgtttcccaatatcatctccacaggcttgtgcagactt
gaaatttttttttactatttatatgtctacttggatatcttcagtgttgtgtgcgtcagt
ctagtgaggtacctcctggtggcatattctacgcgttcctggcccaagaagcagtccctc
ggatgggtactgacatccgctgcactgttaattgcattggtgctgtcgggggatgcctgt
cggcacaggagcagggtggtcgacccggtcagcaagcaggccatgtgttatgagaacgcg
ggaaacatgactgcagactggcgactgcatgtcagaaccgtgtcagttactgcaggtttc
ctgttacccctggccctccttattctgttttatgctctcacctggtgtgtggtgaggagg
acaaagctgcaagccaggcggaaggtaaggggggtgattgttgctgtggtgctgctgttt
tttgtgttttgcttcccttaccacgtactaaatctactggacactctgctaaggcgacgc
tggatccgggacagctgctatacgcgggggttgataaacgtgggtctggcagtaacctcg
ttactgcaggcactgtacagcgccgttgttcccctgatatactcctgcctgggatccctc
tttaggcagaggatgtacggtctcttccaaagcctcaggcagtctttcatgtccggcgcc
accacgtag

DBGET integrated database retrieval system