KEGG   Viruses: 956110
Entry
956110            CDS       T40000                                 

Gene name
env, Siv2gp7
Definition
(RefSeq) Simian immunodeficiency virus SIV-mnd 2; env protein
  KO
K19287  HIV envelope glycoprotein gp160
Taxonomy
TAX:159122
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus; Puma lentivirus; Simian immunodeficiency virus - mnd
Organism
vg  Viruses (Simian immunodeficiency virus)
SSDB
Motif
Pfam: GP120 GP41 TbpB_A
Other DBs
NCBI-GeneID: 956110
NCBI-ProteinID: NP_758892
RS: NC_004455
UniProt: Q8AII4
LinkDB
Position
NC_004455:6309..8909
AA seq 866 aa
MLRYIILGIIVGLGLGNQWVTVYYGTPKWHKAETHLFCATENDSLWVTTSCVPSLLHYEE
QPIPNITWNFTGPMEENEVVMQAWGAISSMIDAVLKPCVKLTPYCVKMQCTKGKDLATPI
PTTSTTTTTTTTKTVANTTELDIDTNNTETTTQQNRVCKFNTTGLCRDCKLEIEENFRYE
DVTCTNGTNNTYSCYMTQCNTSVITQDCNKASTDEIKFRLCAPPGYVLLRCLERLNVSKK
CTNITAVQCTQPLPATTSTMCGSSGTKHDYNELIQTNTKKGKEEFHDHKYVYRVDEKYNL
QVVCRRKGNRSVISTPSATGLIFYSGLEPGKNLKKGMCQLKGQWGIAMHDLAIELRKIDS
SIWRNVTKGYCKGLKRKENRTGCALKTIKVSDYTTKGEPGAETIMLLCGGEYFFCNWTKI
WRTWNDQNSSVWYPWMSCNIRQIIDDWHKVGKKIYMPPVSGFNNEIRCSNDVTEMFFEVQ
KTEEGYIIKFVPQDEVQNRFTAVGAHYQLVKVDPIGFAPTEVARYHLPEARQKRGAVLLG
MFGLLGLAGSTMGSVAVALTVQSQALLNGIVEQQKVLLSLIDQHSELLKLTIWGVKNLQA
RLTALEDYVADQARLSMWGCSFAQVCHTHVPWPNDSITPNWTSETWLEWDKRVTALTDNM
TVNLQKAYELEQKNIYELEKLGDWTSWASWFDFTWWLKYVKIGLLIVIVIIVLRILACLW
SVLGKFRQGYRPLPYVFKGDYLRPHNLKQPGKEREEEPDSEKQSTKSDSSKVEFGKPWSK
EQIRDWLKTSRGYVWLKNLQAVIEYGWQELKTAGGKIFKVLQGYAQGLWSRGHQWGLSTA
ACFRAIARGIINIPRRIRQGAEVLLN
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgcttaggtacataatattaggaataattgtaggactagggttaggaaaccaatgggtg
acagtatattatggcacacctaaatggcataaggcagagacacacctgttctgtgcaaca
gaaaatgattccttatgggtaacaactagttgtgttcccagcttgttgcactatgaagag
caaccaattccgaacataacatggaatttcacaggtcccatggaagaaaatgaggtagta
atgcaagcatggggagctatctcctccatgatagacgcagtattaaaaccttgtgtgaaa
ctgaccccatactgtgtcaagatgcagtgtacaaaaggaaaagaccttgctacccctata
cccactacatccaccacaactaccacaactaccaccaagacggtggcaaatactactgag
ttggacatagacaccaataacactgaaactacaacacaacagaacagggtctgtaaattc
aatactacaggattatgtagggattgcaaattggagatagaagaaaattttagatatgaa
gatgtaacttgtacaaatggcacaaataacacatattcttgttatatgacacaatgcaat
acatcagtaataacccaggactgtaataaagcatccacagatgaaataaaatttagactg
tgtgcacctccaggatatgttctcttgaggtgcctagaaagattgaatgtctctaaaaaa
tgtaccaatatcacagcagtacagtgtacacagccattgccagccaccacctcaactatg
tgtggatctagtgggacaaaacatgattataatgaattaatacagacaaatacaaagaaa
ggcaaagaggagtttcatgaccataagtatgtgtatagagtagatgagaagtacaactta
caagtagtatgtagaagaaaaggaaacagatctgtgatctcaacacctagtgcaacggga
ttgatcttttatagtgggttagaaccagggaaaaatcttaagaaaggtatgtgtcagttg
aagggacaatggggaatagccatgcatgatctagcaatagaattaagaaaaatagacagc
tccatatggagaaatgtaacaaagggctattgcaaggggttaaaaagaaaggaaaataga
acgggttgtgcccttaaaacaataaaggtctctgactacaccacgaaaggcgaaccagga
gcagaaactattatgctcctctgtggaggagaatacttcttttgtaattggacaaaaatt
tggagaacatggaatgatcaaaattcatcagtatggtatccatggatgtcatgtaatatt
agacaaataatagatgattggcataaagtaggaaagaagatttatatgcctcctgtatct
ggatttaataatgagataagatgttctaatgatgtaacagaaatgttctttgaggttcaa
aagacagaagagggatacatcatcaaatttgtgccacaagatgaggtacaaaaccgattt
acagcggtaggagcacactatcaactagtaaaagtggacccaattggctttgctcctaca
gaagtggcaagatatcatctgccagaagctaggcagaagaggggagcggtcttgcttggg
atgttcggcctcctaggtttggcaggttccacgatgggctcagtggcggtggccctgact
gtccagtctcaggctttgttgaatgggattgtggagcagcagaaggttctgctgagcctg
atagatcagcactccgagttattaaaactaactatctggggtgtaaagaatcttcaggcc
cgccttacagccttggaggactatgtagctgatcaagcaagactatccatgtggggctgc
tcattcgcccaggtatgccacacacatgtaccatggccaaatgactctataacaccaaat
tggacctcagagacatggctggaatgggataaaagagtaacagctctaactgacaatatg
acagtaaacttacagaaggcatatgaattggagcaaaagaatatatatgagctagaaaaa
ttaggagattggacttcctgggctagctggttcgactttacgtggtggcttaaatatgtt
aagataggtttactaatagtaatagtgattatagtgttaaggattttagcttgcttatgg
tcagtcttaggaaagtttaggcagggttatcgccctcttccttatgtcttcaagggagac
tatctccgtccccacaacctcaaacagccaggcaaagaaagagaagaagagcccgactca
gaaaaacagagtaccaaatcagacagctccaaagtagaatttgggaagccttggagcaaa
gagcaaatcagagattggctgaagacttcaaggggctacgtgtggctgaagaatctacaa
gcagtaattgaatatgggtggcaagagctcaaaacagcaggaggaaaaatatttaaagta
ctacaaggctatgcgcaggggctatggagcagagggcaccaatggggactatcaacagct
gcatgcttcagagccattgctaggggcattatcaacatcccaagaagaattcgacaggga
gcagaagtcctcctcaactga

DBGET integrated database retrieval system