Vibrio sp. dhg: DBX26_01505 Help Entry DBX26_01505       CDS       T11094                                  Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vid  Vibrio sp. dhg Pathway vid00670   One carbon pool by folate vid00790   Folate biosynthesis vid01100   Metabolic pathways vid01240   Biosynthesis of cofactors vid04981   Folate transport and metabolism Module vid_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vid00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DBX26_01505    00670 One carbon pool by folate     DBX26_01505  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     DBX26_01505 Enzymes [BR:vid01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      DBX26_01505 SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AXT69787 LinkDB All DBs Position 1:306264..306743 Genome browser AA seq 159 aa AA seqDB search MIISMIAAMADNRIIGKDNQMPWHLPADFVWFKRCTMGKPVVMGRKTYESIGRPLPGRLN IVISRDESLSIEGVTTVTSIEQALEVAGDVEEVMIIGGGAIYSACLPLATKLYVTHIEAA IEGDTQFPDWGNEFKETYSEAYQADEKNAYNMRFTILEK NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcattagtatgattgccgcgatggcagacaatcgtatcattggtaaagataatcaa atgccatggcacttgccggctgacttcgtatggtttaagcgttgcaccatgggtaagccc gtcgtcatgggacgcaaaacgtatgagtctatcggacgtccgttgcctggtcgtcttaat atcgttatcagtcgtgatgaatctctaagtatcgaaggagtgacgacagtgacatccatc gagcaagcattagaggttgcgggtgatgtggaagaagtgatgatcattggtggtggagct atttactcagcctgtctaccactcgcaacgaagttgtatgtgacacatattgaggcagct atcgaaggtgatacgcagttccctgattgggggaatgagtttaaagaaacttattctgaa gcgtatcaagcggatgagaaaaacgcctacaacatgcgctttacgattctggaaaaataa

DBGET integrated database retrieval system