Virgibacillus sp. MSP4-1: GWK91_13570 Help Entry GWK91_13570       CDS       T06398                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vim  Virgibacillus sp. MSP4-1 Pathway vim00790   Folate biosynthesis vim01100   Metabolic pathways vim01240   Biosynthesis of cofactors Module vim_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vim00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GWK91_13570 (folB) Enzymes [BR:vim01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GWK91_13570 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GWK91_13570 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GWK91_13570 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QHS23908 UniProt:  A0A6B9YGQ9 LinkDB All DBs Position 2792248..2792613 Genome browser AA seq 121 aa AA seqDB search MDKIHVKGMKFYGYHGLYPEENKLGQRYIVHLTIETDLSKAGKTDHMDNSIDYGRIYEVT KEIVEGRARKLVEALAEDIASQLFHAFPTINGINVEIEKPEAPIPGQFDAVGVEIYRENP L NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggataaaatacatgtaaagggaatgaagttttacggataccacgggttgtatccggaa gaaaataaactgggtcagcggtatatcgttcatttaaccattgaaacggacctttcaaag gcaggaaagaccgatcatatggataatagcatcgattacggcaggatttatgaagttacg aaagaaatcgttgagggaagagccaggaagcttgtggaagcattagctgaggacattgcc agtcagctgtttcatgcgtttccgaccatcaacggcataaatgtggaaattgaaaagcca gaagctcctattccaggacaatttgatgctgtaggggtagagatttacagggagaatcca ttatga

DBGET integrated database retrieval system