Varanus komodoensis (Komodo dragon): 123024083 Help Entry 123024083         CDS       T07701                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism vko  Varanus komodoensis (Komodo dragon) Pathway vko03260   Virion - Human immunodeficiency virus vko03264   Virion - Flavivirus and Alphavirus vko03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus vko03273   Virion - Lassa virus and SFTS virus vko04145   Phagosome vko04517   IgSF CAM signaling vko04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:vko00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     123024083    03264 Virion - Flavivirus and Alphavirus     123024083    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     123024083    03273 Virion - Lassa virus and SFTS virus     123024083  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123024083  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123024083  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123024083  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vko04131]     123024083   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:vko04054]     123024083    04515 Cell adhesion molecules [BR:vko04515]     123024083    04090 CD molecules [BR:vko04090]     123024083    04091 Lectins [BR:vko04091]     123024083 Membrane trafficking [BR:vko04131]  Endocytosis   Phagocytosis    C-lectin receptors     123024083 Pattern recognition receptors [BR:vko04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    123024083 Cell adhesion molecules [BR:vko04515]  Lectins   Selectins and C-type lectins    123024083 CD molecules [BR:vko04090]  Proteins   123024083 Lectins [BR:vko04091]  C-Type lectins   Asialoglycoprotein and DC receptors    123024083 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C TMEM132_C Chordopox_A33R Motif Other DBs NCBI-GeneID:  123024083 NCBI-ProteinID:  XP_044287312 Ensembl:  ENSVKKG00000009057 UniProt:  A0A8D2JJ87 LinkDB All DBs Position Unknown AA seq 214 aa AA seqDB search MEDQKFQDDFRTYTGRHCIQGSIFYIYVLLGVSCLLSAIFLIVAVSKATSLSSELSTMNT ERPKPKPGLDHELFPCGPETRQWEYFNGKCYYFSYEKTSWMQAKVQCEDRQSMLVIVNDM PEQNFLQTRTRNERYWIGLHDRDIEGHWRWIDGTSYFSGFTYWKQGEPNDDAHGEDCAHL WGNGEWNDVYCTYQCYYICEKPLPGARSEHQWRT NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atggaggatcaaaagtttcaagatgacttccggacttatactggcagacattgcatccag ggatccatcttctacatctatgtactgctgggtgtctcttgcctgctgagtgccattttc ctcattgtggctgtttctaaagcaacatctctttcatcggagctgagcacaatgaacact gaacgtccaaaaccaaaacctggacttgatcatgaattatttccatgtggtcctgagacg cgacaatgggaatacttcaatggaaaatgctactacttctcctatgagaaaacctcctgg atgcaggccaaagttcagtgtgaggataggcaatcaatgttggtcattgtcaacgatatg cctgaacagaatttccttcagacccggaccagaaatgaacgttactggattggactccat gacagagatattgaaggacactggaggtggatagatggcaccagctacttcagcggcttc acgtactggaagcaaggggagcccaatgatgatgcccatggagaggactgcgcacatctc tggggcaatggggaatggaatgacgtctactgcacttaccagtgctactatatctgtgaa aagcccttgccgggcgcaaggtcagagcatcagtggcgcacctga

DBGET integrated database retrieval system