Varanus komodoensis (Komodo dragon): 123024083 Help Entry 123024083         CDS       T07701                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism vko  Varanus komodoensis (Komodo dragon) Pathway vko03260   Virion - Human immunodeficiency virus vko03264   Virion - Flavivirus and Alphavirus vko03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus vko03273   Virion - Lassa virus and SFTS virus vko04145   Phagosome vko04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:vko00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     123024083    03264 Virion - Flavivirus and Alphavirus     123024083    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     123024083    03273 Virion - Lassa virus and SFTS virus     123024083  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123024083  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123024083  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vko04131]     123024083   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:vko04054]     123024083    04515 Cell adhesion molecules [BR:vko04515]     123024083    04090 CD molecules [BR:vko04090]     123024083    04091 Lectins [BR:vko04091]     123024083 Membrane trafficking [BR:vko04131]  Endocytosis   Phagocytosis    C-lectin receptors     123024083 Pattern recognition receptors [BR:vko04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    123024083 Cell adhesion molecules [BR:vko04515]  Lectins   Selectins and C-type lectins    123024083 CD molecules [BR:vko04090]  Proteins   123024083 Lectins [BR:vko04091]  C-Type lectins   Asialoglycoprotein and DC receptors    123024083 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C TMEM132_C Chordopox_A33R Motif Other DBs NCBI-GeneID:  123024083 NCBI-ProteinID:  XP_044287312 Ensembl:  ENSVKKG00000009057 UniProt:  A0A8D2JJ87 LinkDB All DBs Position Unknown AA seq 214 aa AA seqDB search MEDQKFQDDFRTYTGRHCIQGSIFYIYVLLGVSCLLSAIFLIVAVSKATSLSSELSTMNT ERPKPKPGLDHELFPCGPETRQWEYFNGKCYYFSYEKTSWMQAKVQCEDRQSMLVIVNDM PEQNFLQTRTRNERYWIGLHDRDIEGHWRWIDGTSYFSGFTYWKQGEPNDDAHGEDCAHL WGNGEWNDVYCTYQCYYICEKPLPGARSEHQWRT NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atggaggatcaaaagtttcaagatgacttccggacttatactggcagacattgcatccag ggatccatcttctacatctatgtactgctgggtgtctcttgcctgctgagtgccattttc ctcattgtggctgtttctaaagcaacatctctttcatcggagctgagcacaatgaacact gaacgtccaaaaccaaaacctggacttgatcatgaattatttccatgtggtcctgagacg cgacaatgggaatacttcaatggaaaatgctactacttctcctatgagaaaacctcctgg atgcaggccaaagttcagtgtgaggataggcaatcaatgttggtcattgtcaacgatatg cctgaacagaatttccttcagacccggaccagaaatgaacgttactggattggactccat gacagagatattgaaggacactggaggtggatagatggcaccagctacttcagcggcttc acgtactggaagcaaggggagcccaatgatgatgcccatggagaggactgcgcacatctc tggggcaatggggaatggaatgacgtctactgcacttaccagtgctactatatctgtgaa aagcccttgccgggcgcaaggtcagagcatcagtggcgcacctga

DBGET integrated database retrieval system