Vulpes lagopus (Arctic fox): 121476667 Help Entry 121476667         CDS       T07435                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04010   MAPK signaling pathway vlg04014   Ras signaling pathway vlg04015   Rap1 signaling pathway vlg04024   cAMP signaling pathway vlg04062   Chemokine signaling pathway vlg04510   Focal adhesion vlg04517   IgSF CAM signaling vlg04520   Adherens junction vlg04611   Platelet activation vlg04670   Leukocyte transendothelial migration vlg04720   Long-term potentiation vlg04722   Neurotrophin signaling pathway vlg04934   Cushing syndrome vlg04972   Pancreatic secretion vlg05211   Renal cell carcinoma vlg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121476667    04014 Ras signaling pathway     121476667    04015 Rap1 signaling pathway     121476667    04024 cAMP signaling pathway     121476667   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121476667  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121476667    04520 Adherens junction     121476667  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     121476667    04670 Leukocyte transendothelial migration     121476667    04062 Chemokine signaling pathway     121476667   09154 Digestive system    04972 Pancreatic secretion     121476667   09156 Nervous system    04720 Long-term potentiation     121476667    04722 Neurotrophin signaling pathway     121476667  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     121476667   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121476667   09167 Endocrine and metabolic disease    04934 Cushing syndrome     121476667  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121476667    04031 GTP-binding proteins [BR:vlg04031]     121476667 Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121476667   Exosomal proteins of other body fluids (saliva and urine)    121476667   Exosomal proteins of colorectal cancer cells    121476667 GTP-binding proteins [BR:vlg04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     121476667 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 Motif Other DBs NCBI-GeneID:  121476667 NCBI-ProteinID:  XP_041586740 LinkDB All DBs Position 15:21176042..21178021 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPMIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctatgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaatggacaaggctttgcatta gtttactccatcacagcacagtctacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system