Vulpes lagopus (Arctic fox): 121485411 Help Entry 121485411         CDS       T07435                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg00510   N-Glycan biosynthesis vlg00513   Various types of N-glycan biosynthesis vlg04141   Protein processing in endoplasmic reticulum Module vlg_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:vlg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121485411    00513 Various types of N-glycan biosynthesis     121485411  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121485411 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  121485411 NCBI-ProteinID:  XP_041601626 LinkDB All DBs Position 2:complement(7474054..7475597) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPEVFPHLTVMLLATGVFFTTWVFVYEITSTKYTRDIYKELLISLVA TLFMGFGVLFLLLWVSIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagtagatacaccagcccagtgaaccctgaggttttcccccat ctgactgtgatgctattggcaactggcgtgttttttaccacctgggtctttgtttatgag atcacctccaccaagtacactcgggatatctacaaagaactcctcatctccttggtggcc acactcttcatgggctttggagtcctctttctgctgctctgggtcagcatctatgtatga

DBGET integrated database retrieval system