Vulpes lagopus (Arctic fox): 121486320 Help Entry 121486320         CDS       T07435                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg00510   N-Glycan biosynthesis vlg00513   Various types of N-glycan biosynthesis vlg04141   Protein processing in endoplasmic reticulum Module vlg_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:vlg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121486320    00513 Various types of N-glycan biosynthesis     121486320  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121486320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  121486320 NCBI-ProteinID:  XP_041603122 LinkDB All DBs Position 3:94447951..94448834 Genome browser AA seq 88 aa AA seqDB search MTLFLPPGEVELEAMSRYTSPVNLVVFPHLTMVLLAIGMFFTVWFFIYEVTSTKDTRNIY KELLISLVASLFMGFGVLFLLLWVGIYV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaccctgtttttgccacctggcgaagtggagctcgaggccatgagcagatacaccagc ccagtgaaccttgtcgtcttcccccatctgaccatggtgctattggcaattggcatgttc tttaccgtctggttcttcatttatgaggtcacgtccaccaaggacactcggaatatctac aaagagctcctcatctccttggtggcctcactcttcatgggttttggagtcctcttcctg ctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system