Vulpes lagopus (Arctic fox): 121491993 Help Entry 121491993         CDS       T07435                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg03050   Proteasome vlg04060   Cytokine-cytokine receptor interaction vlg04066   HIF-1 signaling pathway vlg04217   Necroptosis vlg04350   TGF-beta signaling pathway vlg04380   Osteoclast differentiation vlg04612   Antigen processing and presentation vlg04630   JAK-STAT signaling pathway vlg04650   Natural killer cell mediated cytotoxicity vlg04657   IL-17 signaling pathway vlg04658   Th1 and Th2 cell differentiation vlg04659   Th17 cell differentiation vlg04660   T cell receptor signaling pathway vlg04940   Type I diabetes mellitus vlg05140   Leishmaniasis vlg05142   Chagas disease vlg05143   African trypanosomiasis vlg05144   Malaria vlg05145   Toxoplasmosis vlg05146   Amoebiasis vlg05152   Tuberculosis vlg05160   Hepatitis C vlg05164   Influenza A vlg05168   Herpes simplex virus 1 infection vlg05200   Pathways in cancer vlg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vlg05321   Inflammatory bowel disease vlg05322   Systemic lupus erythematosus vlg05323   Rheumatoid arthritis vlg05330   Allograft rejection vlg05332   Graft-versus-host disease vlg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     121491993 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     121491993 (IFNG)    04630 JAK-STAT signaling pathway     121491993 (IFNG)    04066 HIF-1 signaling pathway     121491993 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121491993 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121491993 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     121491993 (IFNG)    04612 Antigen processing and presentation     121491993 (IFNG)    04660 T cell receptor signaling pathway     121491993 (IFNG)    04658 Th1 and Th2 cell differentiation     121491993 (IFNG)    04659 Th17 cell differentiation     121491993 (IFNG)    04657 IL-17 signaling pathway     121491993 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     121491993 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121491993 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121491993 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     121491993 (IFNG)    05164 Influenza A     121491993 (IFNG)    05168 Herpes simplex virus 1 infection     121491993 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     121491993 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     121491993 (IFNG)    05144 Malaria     121491993 (IFNG)    05145 Toxoplasmosis     121491993 (IFNG)    05140 Leishmaniasis     121491993 (IFNG)    05142 Chagas disease     121491993 (IFNG)    05143 African trypanosomiasis     121491993 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     121491993 (IFNG)    05323 Rheumatoid arthritis     121491993 (IFNG)    05321 Inflammatory bowel disease     121491993 (IFNG)    05330 Allograft rejection     121491993 (IFNG)    05332 Graft-versus-host disease     121491993 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121491993 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121491993 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:vlg03051]     121491993 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121491993 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:vlg00536]     121491993 (IFNG) Proteasome [BR:vlg03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     121491993 (IFNG) Cytokines and neuropeptides [BR:vlg04052]  Cytokines   Interferons    121491993 (IFNG) Glycosaminoglycan binding proteins [BR:vlg00536]  Heparan sulfate / Heparin   Cytokines    121491993 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma TssR_C Motif Other DBs NCBI-GeneID:  121491993 NCBI-ProteinID:  XP_041613129 LinkDB All DBs Position 5:59140099..59144378 Genome browser AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILCSSGCNCQAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWR EESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQ IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctatatcttagcttttcagctttgcgtgattttgtgttcttctggc tgtaactgtcaggccatgttttttaaagaaatagaaaacctaaaggaatattttaacgca agtaatccagatgtatcggatggtgggtctcttttcgtagatattttgaagaaatggaga gaggagagtgacaaaacaatcattcagagccaaattgtctctttctacttgaaactgttt gacaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttggcaagttcttaaatagcagcaccagtaagagggaggacttccttaagctgattcaa attcctgtgaacgatctgcaggtccagcgcaaggcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatccaacctaaggaagcggaaaaggagtcagaatctgtttcga ggccgcagagcatcgaaataa

DBGET integrated database retrieval system