Vulpes lagopus (Arctic fox): 121493811 Help Entry 121493811         CDS       T07435                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg01522   Endocrine resistance vlg04010   MAPK signaling pathway vlg04024   cAMP signaling pathway vlg04210   Apoptosis vlg04380   Osteoclast differentiation vlg04620   Toll-like receptor signaling pathway vlg04657   IL-17 signaling pathway vlg04658   Th1 and Th2 cell differentiation vlg04659   Th17 cell differentiation vlg04660   T cell receptor signaling pathway vlg04662   B cell receptor signaling pathway vlg04668   TNF signaling pathway vlg04713   Circadian entrainment vlg04725   Cholinergic synapse vlg04728   Dopaminergic synapse vlg04915   Estrogen signaling pathway vlg04917   Prolactin signaling pathway vlg04921   Oxytocin signaling pathway vlg04926   Relaxin signaling pathway vlg04928   Parathyroid hormone synthesis, secretion and action vlg04932   Non-alcoholic fatty liver disease vlg04935   Growth hormone synthesis, secretion and action vlg05031   Amphetamine addiction vlg05132   Salmonella infection vlg05133   Pertussis vlg05135   Yersinia infection vlg05140   Leishmaniasis vlg05142   Chagas disease vlg05161   Hepatitis B vlg05162   Measles vlg05166   Human T-cell leukemia virus 1 infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05170   Human immunodeficiency virus 1 infection vlg05171   Coronavirus disease - COVID-19 vlg05200   Pathways in cancer vlg05207   Chemical carcinogenesis - receptor activation vlg05208   Chemical carcinogenesis - reactive oxygen species vlg05210   Colorectal cancer vlg05224   Breast cancer vlg05231   Choline metabolism in cancer vlg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vlg05323   Rheumatoid arthritis vlg05417   Lipid and atherosclerosis vlg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121493811 (FOS)    04668 TNF signaling pathway     121493811 (FOS)    04024 cAMP signaling pathway     121493811 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121493811 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121493811 (FOS)    04660 T cell receptor signaling pathway     121493811 (FOS)    04658 Th1 and Th2 cell differentiation     121493811 (FOS)    04659 Th17 cell differentiation     121493811 (FOS)    04657 IL-17 signaling pathway     121493811 (FOS)    04662 B cell receptor signaling pathway     121493811 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     121493811 (FOS)    04917 Prolactin signaling pathway     121493811 (FOS)    04921 Oxytocin signaling pathway     121493811 (FOS)    04926 Relaxin signaling pathway     121493811 (FOS)    04935 Growth hormone synthesis, secretion and action     121493811 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     121493811 (FOS)   09156 Nervous system    04725 Cholinergic synapse     121493811 (FOS)    04728 Dopaminergic synapse     121493811 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     121493811 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     121493811 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121493811 (FOS)    05207 Chemical carcinogenesis - receptor activation     121493811 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     121493811 (FOS)    05231 Choline metabolism in cancer     121493811 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121493811 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     121493811 (FOS)    05224 Breast cancer     121493811 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121493811 (FOS)    05170 Human immunodeficiency virus 1 infection     121493811 (FOS)    05161 Hepatitis B     121493811 (FOS)    05171 Coronavirus disease - COVID-19     121493811 (FOS)    05162 Measles     121493811 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     121493811 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     121493811 (FOS)    05135 Yersinia infection     121493811 (FOS)    05133 Pertussis     121493811 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121493811 (FOS)    05142 Chagas disease     121493811 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     121493811 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     121493811 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121493811 (FOS)    05418 Fluid shear stress and atherosclerosis     121493811 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     121493811 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     121493811 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:vlg03000]     121493811 (FOS)    04131 Membrane trafficking [BR:vlg04131]     121493811 (FOS) Transcription factors [BR:vlg03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     121493811 (FOS) Membrane trafficking [BR:vlg04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     121493811 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  121493811 NCBI-ProteinID:  XP_041616006 LinkDB All DBs Position 6:complement(25086552..25089933) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSIGSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATEPEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggtttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcg tccccggccggggacaacctctcctactaccactccccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttt atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccgtcccagaccagagccccccacccgtatggagtccccacc ccctcggctggggcttactccagggctggcgttgtgaagaccatgacgggaggcagagct cagagcattggccggaggggcaaggtggaacagctgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccgcaggagggag ctgactgacacgctccaagcggagacagaccaactagaagacgagaagtctgctctgcag accgagatcgccaacctgctgaaggagaaggagaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttccccgaagagatgtccgtggcttcc ctagatctgagcgggggcctgcccgaagctgccaccccggagtccgaggaggctttcacc ctgcccctcctcaatgatcctgagcccaagccctccgtggagcccgtcaagagcatcggc agcatggagctgaaggccgagccctttgatgacttcctgtttccagcatcatccaggccc agcggctcggagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagccc gagcctctgtgcacccccgtagtcacctgtactcctagctgcactacctacacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggccgctcatcgcaag ggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system