Vulpes lagopus (Arctic fox): 121494639 Help Entry 121494639         CDS       T07435                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04060   Cytokine-cytokine receptor interaction vlg04151   PI3K-Akt signaling pathway vlg04217   Necroptosis vlg04380   Osteoclast differentiation vlg04620   Toll-like receptor signaling pathway vlg04621   NOD-like receptor signaling pathway vlg04622   RIG-I-like receptor signaling pathway vlg04623   Cytosolic DNA-sensing pathway vlg04630   JAK-STAT signaling pathway vlg04650   Natural killer cell mediated cytotoxicity vlg04668   TNF signaling pathway vlg04936   Alcoholic liver disease vlg05135   Yersinia infection vlg05142   Chagas disease vlg05152   Tuberculosis vlg05160   Hepatitis C vlg05161   Hepatitis B vlg05162   Measles vlg05163   Human cytomegalovirus infection vlg05164   Influenza A vlg05165   Human papillomavirus infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05168   Herpes simplex virus 1 infection vlg05169   Epstein-Barr virus infection vlg05170   Human immunodeficiency virus 1 infection vlg05171   Coronavirus disease - COVID-19 vlg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121494639 (IFNB1)    04668 TNF signaling pathway     121494639 (IFNB1)    04151 PI3K-Akt signaling pathway     121494639 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121494639 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121494639 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121494639 (IFNB1)    04621 NOD-like receptor signaling pathway     121494639 (IFNB1)    04622 RIG-I-like receptor signaling pathway     121494639 (IFNB1)    04623 Cytosolic DNA-sensing pathway     121494639 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     121494639 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     121494639 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121494639 (IFNB1)    05161 Hepatitis B     121494639 (IFNB1)    05160 Hepatitis C     121494639 (IFNB1)    05171 Coronavirus disease - COVID-19     121494639 (IFNB1)    05164 Influenza A     121494639 (IFNB1)    05162 Measles     121494639 (IFNB1)    05168 Herpes simplex virus 1 infection     121494639 (IFNB1)    05163 Human cytomegalovirus infection     121494639 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     121494639 (IFNB1)    05169 Epstein-Barr virus infection     121494639 (IFNB1)    05165 Human papillomavirus infection     121494639 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     121494639 (IFNB1)    05152 Tuberculosis     121494639 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     121494639 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121494639 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121494639 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vlg04052]     121494639 (IFNB1) Cytokines and neuropeptides [BR:vlg04052]  Cytokines   Interferons    121494639 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  121494639 NCBI-ProteinID:  XP_041617228 LinkDB All DBs Position 7:91999583..92000143 Genome browser AA seq 186 aa AA seqDB search MTGRCIVQTTLLLYFSTMALAMSNDLLRFQLSSSSLECQELLLQLNGTTEYCLKDRVNFE IPEEIEKSRQFQKEDIILITHEMFQKIFDIFRRNISRTGWNETIVENLLVKLHWQKEHLE IILEDVKEKENFTWDNRTLLRLKKYYLRIVQYLKAKEYSICAWTIVRAEICRNFFFLNIL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggtagatgcatcgtccaaacaactctcctgttgtatttctccaccatggctctt gccatgagcaacgacttgcttcgattccaactaagcagcagcagtttggagtgtcaggag ctcctattacagttgaatggaaccactgaatattgcctcaaggacagggtaaacttcgag atccctgaggagatcgagaaatcacgccagttccagaaggaggacatcatattgatcacc catgagatgttccagaagatctttgatattttcaggagaaatatctctagaacaggatgg aatgagactattgtcgagaaccttcttgtgaagctccactggcagaaggaacatctggag ataatcctggaggacgtcaaagagaaggaaaacttcacctgggacaacaggactcttctg cgcctgaagaaatattacttaaggattgtgcagtacctgaaggccaaggaatacagcatc tgtgcctggacaatagtccgagcagaaatctgcaggaactttttcttccttaatatactt acagattatctccagaactga

DBGET integrated database retrieval system